DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstC-R1 and P2ry14

Sequence 1:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_006232458.1 Gene:P2ry14 RGDID:70912 Length:338 Species:Rattus norvegicus

Alignment Length:352 Identity:89/353 (25%)
Similarity:163/353 (46%) Gaps:47/353 (13%)


  Fly    60 TDLPTYQHCIATRNS-FADLFTVVLYGFVCIIGLFGNTLVIYVVLRFSKMQTVTNIYILNLAVAD 123
            |..|..|.|  |||: .......:||..|.|.|:..|.:..::.......::.. ||:.|:.|||
  Rat     6 TTEPPKQPC--TRNTLITQQIIPMLYCVVFITGVLLNGISGWIFFYVPSSKSFI-IYLKNIVVAD 67

  Fly   124 ECFLIGIPF---LLYTMRICSWRFGEFMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSP 185
              ||:|:.|   :|....:..|:...|:|:...|...:..:.|..|..::|.|||..:..|:...
  Rat    68 --FLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFYVNMYVSIAFFGLISFDRYYKIVKPLLVS 130

  Fly   186 RYRTLHIAKVVSAIAWSTSAVLMLP-VILYASTVEQEDGINYSCNIMWPDAYKK-HSGTTFILYT 248
            ..::::.:||:|.:.|....:|.:| :||...:|  :|..|..|..:..:..:| |..:.::..:
  Rat   131 IVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSV--KDVTNIQCMELKNELGRKWHKASNYVFVS 193

  Fly   249 FFLGFATPLCFIL--SFYYLVIRKLRSVGPKPGTKSKEKRRAH-----RKVTRLVLTVISVYILC 306
            .|.     :.|:|  .||..:.||:        .||..|.|.:     ||.:|.:.:::.|:::|
  Rat   194 IFW-----IVFLLLTVFYMAITRKI--------FKSHLKSRKNSISVKRKSSRNIFSIVLVFVVC 245

  Fly   307 WLPHWISQVALIHS-NPAQRDLSRLEILIF-----LLLGALVYSNSAVNPILYAFLSENFRKSFF 365
            ::|:.|:::....| ..........|.|::     |||.|   :|..::||:|.||.:.||:...
  Rat   246 FVPYHIARIPYTKSQTEGHYSCQAKETLLYTKEFTLLLSA---ANVCLDPIIYFFLCQPFREVLN 307

  Fly   366 KAFTCMNKQDINAQLQLEPSVFTKQGS 392
            |..    :..:..|..||.|. |::|:
  Rat   308 KKL----RMSLTVQNDLETSK-TRRGN 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 73/298 (24%)
7tm_1 94..353 CDD:278431 65/277 (23%)
P2ry14XP_006232458.1 7tm_1 40..295 CDD:278431 65/276 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.