DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstC-R1 and LOC100535160

Sequence 1:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_003201711.2 Gene:LOC100535160 ID: Length:351 Species:Danio rerio

Alignment Length:307 Identity:88/308 (29%)
Similarity:148/308 (48%) Gaps:64/308 (21%)


  Fly    85 GFVCIIGLFGNTLVIYVVLRFSKMQTVTNIYILNLAVADECFLIGIPFLLYT-MRICSWRFGEFM 148
            ||:|..||.||.||:..:||.:| :||.::|:.||||||...:|.:|||::. .|...|.||..:
Zfish    54 GFLCSTGLVGNVLVLVTILRSAK-KTVPDVYVGNLAVADLVHVIVMPFLIHQWARGGHWVFGSSL 117

  Fly   149 CKAYMVSTSITSFTS------SIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVL 207
            |      |.|||..:      :..:..||.|||:|:.||......||......::...|:.|.::
Zfish   118 C------TIITSLDNCNQVACAAVMTAMSLDRYLALVHPFRLLSLRTRSRTIRINLFVWAASFIM 176

  Fly   208 MLPVILYASTVEQEDGINYSCN--------IMWPDAYKKHSGTTFILYTFFLGFATPLCFILSFY 264
            :||..::|..:...||:. ||:        ::|           :.||.....|..||..||:.|
Zfish   177 VLPAWVHAKVIRFRDGLE-SCSLNLVSPKQVLW-----------YTLYQTVTSFFLPLPLILTCY 229

  Fly   265 YLVI----RKLRSVGPKPGTKSKEKRRAHR-----------KVTRLVLTVISVYILCWLPHWISQ 314
            .|::    |..|           :.::|||           ::|::||.:::|:::...|:.|.|
Zfish   230 ILILCYTWRMYR-----------KNKKAHRYNTSLPRERVVRLTKMVLVLVAVFLVSVGPYHILQ 283

  Fly   315 VALIHSNPAQRDLSRLEILIFLLLGALVYSNSAVNPILYAFLSENFR 361
              |::.:..:..|:  ....:.|...|.|:.|::||.:|..||.:||
Zfish   284 --LVNLSVPRPSLA--YHTCYYLSVCLSYAASSINPFIYILLSGHFR 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 86/305 (28%)
7tm_1 94..353 CDD:278431 78/289 (27%)
LOC100535160XP_003201711.2 7tmA_MCHR2 47..329 CDD:320461 88/308 (29%)
TM helix 1 48..74 CDD:320461 11/20 (55%)
TM helix 2 80..106 CDD:320461 11/26 (42%)
TM helix 3 118..148 CDD:320461 11/36 (31%)
TM helix 4 160..180 CDD:320461 4/20 (20%)
TM helix 5 206..235 CDD:320461 10/40 (25%)
TM helix 6 256..286 CDD:320461 8/32 (25%)
TM helix 7 297..322 CDD:320461 8/25 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24229
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.