DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstC-R1 and gpr17

Sequence 1:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_005166015.1 Gene:gpr17 ZFINID:ZDB-GENE-100922-133 Length:339 Species:Danio rerio

Alignment Length:337 Identity:94/338 (28%)
Similarity:157/338 (46%) Gaps:41/338 (12%)


  Fly    54 EESLYGTDLPT------YQHCIATRNSFADLFTVVLYGFVCIIGLFGNTLVIYVVLRFSKMQTVT 112
            |.||  |:|||      ...|....|:..::...:.|..|.::.|.||:|.:::..|.....:..
Zfish     2 ESSL--TELPTLLPNQSMDSCPPVENTAENMMFGIYYIIVFLLALSGNSLALWIFARQRNNSSPA 64

  Fly   113 NIYILNLAVADECFLIGIPF-LLYTMRICSWRFGEFMCKAYMVSTSITSFTSSIFLLIMSADRYI 176
            |:::|:|||||..::..:|. ..|.:....|.|||..|:.......:..:.|..||..::.|||:
Zfish    65 NVFLLHLAVADLFYVFILPLRATYHLTGGHWPFGEIPCRLAGFFFYVNMYASLYFLACVAGDRYL 129

  Fly   177 AVCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPVILYASTVEQEDGINYS--CNIMWPDAYKKH 239
            ||.|.:.|.:.|..|.|.:.|...|....|.|.|:::...|||    :|.|  |..::     :.
Zfish   130 AVVHAVRSLKVRRPHYAHIASFALWILVIVSMAPLLITKQTVE----VNGSTVCLQLY-----RE 185

  Fly   240 SGTTFILYTFFLGFATPLCFILSFYYLVIRKLRSVGPKPGTKSKE--KRRAHRKVTRLVLTVISV 302
            ..:...|.:..:.|..|....||.|.|::..||.     |::.:.  |.||    .|.:..|:.:
Zfish   186 KASWRALVSLVVAFTPPFIATLSCYLLIVNSLRK-----GSRLEPALKLRA----LRTIGLVMFI 241

  Fly   303 YILCWLPHWISQVALI--HSNPAQRDLS----RLEILIFLLLGALVYSNSAVNPILYAFLSENFR 361
            |::|:||:.:|:...|  :.:|   |||    |...|...|..:|...|..::|::|.|.:|.||
Zfish   242 YVVCFLPYHLSRATFILGYGHP---DLSCQIKRGLALANRLTSSLTCLNGGLDPLVYLFAAEKFR 303

  Fly   362 KSFFKAFTCMNK 373
            .|..:.| |.:|
Zfish   304 GSVRRIF-CRDK 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 80/291 (27%)
7tm_1 94..353 CDD:278431 73/270 (27%)
gpr17XP_005166015.1 7tmA_GPR17 30..304 CDD:320289 81/295 (27%)
TM helix 1 30..57 CDD:320289 7/27 (26%)
TM helix 2 64..89 CDD:320289 9/25 (36%)
TM helix 3 102..132 CDD:320289 9/30 (30%)
TM helix 4 144..166 CDD:320289 7/22 (32%)
TM helix 5 187..216 CDD:320289 7/29 (24%)
TM helix 6 226..256 CDD:320289 10/34 (29%)
TM helix 7 274..299 CDD:320289 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.