DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstC-R1 and gpr174

Sequence 1:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_005157230.1 Gene:gpr174 ZFINID:ZDB-GENE-100930-1 Length:327 Species:Danio rerio

Alignment Length:378 Identity:81/379 (21%)
Similarity:145/379 (38%) Gaps:96/379 (25%)


  Fly    60 TDLPTYQHCIATRNSFADLFTVVLYGFVCIIGLFGNTLVIYVVLRFSKMQTVTNIYILNLAVADE 124
            |.:..|||.|     :|..:|::|     |.||.||.|.:::...:.|......|:::|||:||.
Zfish    11 TSIQDYQHQI-----YAVFYTLIL-----IPGLIGNVLALWIFYAYVKETKKAVIFMINLAIADL 65

  Fly   125 CFLIGIPFLLYTMRICSWRFGEFMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRT 189
            ..::.:|..:|.....||.||:..|........:..:.|..||..:|..|...:..|:|      
Zfish    66 LQVLSLPLRVYYYLNNSWPFGKAACMICFYLKYVNMYASIYFLACISLRRCRLIFKPLS------ 124

  Fly   190 LHIAKVVSA----IAWSTSAVLMLPVILYASTVEQEDGINYSCNIMWP-DAYKKHSGTTFILYTF 249
            ..|.|....    :.|....|..||..|    :.|.:.....|....| ...||..|.:.:....
Zfish   125 CDIMKGQDRRWCFVGWFVVCVGCLPFPL----LRQSERNPQCCFAELPMMQLKKELGVSLLAVAE 185

  Fly   250 FLGFATPLCFILSFYYLVIRKLR-------SVGPKPGTKSKEKRRAHRKVTRLVLTVISVYILCW 307
            ..||..||..:::..:|....||       ..|.|            .|..::||:...|:::|:
Zfish   186 MTGFLLPLAIVITCTWLTTASLREKTCLLHDTGEK------------HKALKMVLSCACVFMICF 238

  Fly   308 LPHWIS-----------------QVALIHSNPAQRDLSRLEILIFLLLGALVYSNSAVNPILYAF 355
            :|:.|:                 :.|::|.:|           |.|.|.:|   |..::|::|.|
Zfish   239 VPYHITFPLDFLTKSNFNMSATFKNAVLHVHP-----------ITLCLASL---NCCLDPVMYYF 289

  Fly   356 LSENFRKSFFKAFTCMNKQDINAQLQLEPSVFTKQGSKKRGGSKRLLTSNPQI 408
            .::.|::.       :::.::....||...:|              ..:||::
Zfish   290 TTDEFKRR-------LSRTELQESFQLHQRIF--------------CPTNPEV 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 68/309 (22%)
7tm_1 94..353 CDD:278431 62/288 (22%)
gpr174XP_005157230.1 7tm_GPCRs 19..298 CDD:333717 72/332 (22%)
TM helix 1 21..45 CDD:320095 9/29 (31%)
TM helix 2 54..75 CDD:320095 7/21 (33%)
TM helix 3 91..113 CDD:320095 4/22 (18%)
TM helix 4 134..150 CDD:320095 4/16 (25%)
TM helix 5 178..201 CDD:320095 4/23 (17%)
TM helix 6 221..246 CDD:320095 7/25 (28%)
TM helix 7 266..291 CDD:320095 10/39 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.