DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7402 and galns

Sequence 1:NP_649023.1 Gene:CG7402 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_001074110.2 Gene:galns ZFINID:ZDB-GENE-070112-1152 Length:514 Species:Danio rerio

Alignment Length:549 Identity:154/550 (28%)
Similarity:230/550 (42%) Gaps:107/550 (19%)


  Fly     7 LVLLVVSSILSLAYGSGYSTKPNIVIILIDDMGMNDVSFHGSNQILTPNIDALAYNGILLNKHYV 71
            :.|..|..:|...|....|..|||:|:|:||||..|:...|.....||.:|.:|..|:|....|.
Zfish     1 MCLQAVICVLWTVYVCQTSGSPNIIIMLMDDMGWGDLGVFGEPSKETPYLDLMAAQGMLFPNFYT 65

  Fly    72 PN-LCTPSRATLLTGKYPIHTGM-------------QHFVIITDEPWGLPQRERLMPEIFRDAGY 122
            .| ||:||||.||||:.|:..|.             |..|      .|:...|.|:||:.::..|
Zfish    66 ANPLCSPSRAALLTGRLPVRNGFYTTNAHARNAYTPQEIV------GGISADEILLPELLKNKHY 124

  Fly   123 STHLVGKWHLGFWRKDLTPTMRGFDH-------HFGYYNG----YIDYYDHQVRMLDRNYSAGLD 176
            .:.:|||||||. |....|...|||.       |||.||.    .|..|::. .|..|.|.   :
Zfish   125 VSKIVGKWHLGH-RTQYLPLKHGFDEWFGAPNCHFGPYNDSSRPNIPVYNNS-EMKGRYYE---E 184

  Fly   177 FRRDLEPCPEANGTYATEAFTSEAKRIIEQHDKS-KPLFMVLSHLAVHTGNEDSPMQAPEEEVAK 240
            |..::: ..|:|   .|:.:..|....|.|...: :|.|:..:..|.|     :|:.|.:     
Zfish   185 FEINVK-TGESN---LTQLYLKEGLDFISQQAMAQRPFFLYWAPDATH-----APVYASK----- 235

  Fly   241 FPHIRDPKRRTYAGMISSLDKSVAQTIGALKDNGMLNNSIILLYSDNGAPTIGIHSNAGSNYPYR 305
             |.:...:|..|...:..||.|:.|.:..|...|:.|::::...|||||..:.....:|||.|:.
Zfish   236 -PFLGKSQRGRYGDAVMELDDSIGQILAHLVSLGIQNDTLVFFTSDNGAALMSGPLQSGSNAPFL 299

  Fly   306 GQKESPWEGGIRSAGALWSPLLKERGYVSNQAIHAVDWLPTLAGAAGVSLPQDLPLDGINLWPML 370
            ..||:.:|||:|.....|.|.....|.||:|....:|...|....||||.|.|..:||::|.|:|
Zfish   300 CGKETTFEGGMREPAMAWWPGQIPAGTVSHQLASVMDLFSTSLSVAGVSPPDDRVIDGVDLSPVL 364

  Fly   371 SGNEEPKPRTMIHVLDEVFGYSSYMRDTLKYVNGSSFKGRYDQWLGELETNEDDPLGESYEQHVL 435
            ....         ::|....|  |..:.:..|....:|..|..|...:|.               
Zfish   365 FNGS---------LIDRPIFY--YRGNQMMAVRIGQYKAHYWTWSNSMEE--------------- 403

  Fly   436 ASDVQSLLGNRGLTKDRIRQMRSEATETCPPIEGQN--PLESHFKCEPLKAPCFFDLAKDPCERY 498
                    .|:|:             ..||   ||.  .:.:|.:.|....|..|.|.:||.|||
Zfish   404 --------FNKGI-------------NFCP---GQEVPGVTTHTQQEHTMQPLIFHLGRDPGERY 444

  Fly   499 NLA---QMYPLQLQQLADELEQIRKTAIP 524
            .|:   :.|....:::...:||.:|..||
Zfish   445 PLSVQCKEYRDVFRRVTAVVEQHQKLLIP 473

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 129/460 (28%)
4-S 28..436 CDD:293753 126/434 (29%)
galnsNP_001074110.2 AslA 18..475 CDD:225661 150/533 (28%)
GALNS 22..486 CDD:293776 149/529 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87927531
eggNOG 1 0.900 E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.