DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7402 and arsd

Sequence 1:NP_649023.1 Gene:CG7402 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_001015952.1 Gene:arsd XenbaseID:XB-GENE-5874310 Length:499 Species:Xenopus tropicalis

Alignment Length:579 Identity:132/580 (23%)
Similarity:200/580 (34%) Gaps:182/580 (31%)


  Fly    83 LTGKYPIHTGMQ-----HFVIITDEPWGLPQRERLMPEIFRDAGYSTHLVGKWHLGF---WRKDL 139
            :||:|||.:||.     ..::......|||..|.....|.:..||||.|:||||||.   .|.|.
 Frog     1 MTGRYPIRSGMDFSNGFRVIVSAAVSAGLPSNETTFATILQQQGYSTGLIGKWHLGLNCASRDDF 65

  Fly   140 T--PTMRGFDHHFG----YYNG------------------------------------------- 155
            .  |...||::.:|    .|:|                                           
 Frog    66 CHHPNSHGFNYFYGMPFSLYSGCKPGSIPESPNSPKQQLSFVTQIIGFGVLTLTALKYSKILAIN 130

  Fly   156 --------------YIDYY------DHQVRMLDRNYSAGLDFRRDLEPCPEANGTYATEAFTSEA 200
                          :|.:|      .|...|:.||:        ::...| .|...:|.....||
 Frog   131 GKFLVSCAVFDLLFFITWYTLYHYAHHWNCMIMRNH--------EITEQP-MNIERSTSQILKEA 186

  Fly   201 KRIIEQHDKSKPLFMVLSHLAVHTGNEDSPMQAPEEEVAKFPHIRDPKRRTYAGMISSLDKSVAQ 265
            ...||: :|:.|..:.:|.|..|.     |:...::...:..|      .||...|..:|..|..
 Frog   187 HGFIER-NKNVPFLLFVSFLHAHI-----PLITTKKFTGRSNH------GTYGDSIEEMDYLVGS 239

  Fly   266 TIGALKDNGMLNNSIILLYSDNGAPTIGIHSN---AGSNYPYRGQKE-SPWEGGIRSAGALWSPL 326
            .:.|:...|:.||:.|...||:|........|   .|.|..|:|.|. :.||||||..|....|.
 Frog   240 VVDAIDTAGLKNNTFIYFTSDHGGHLEAADGNIQLGGWNGIYKGGKAVAGWEGGIRVPGIFRWPG 304

  Fly   327 LKERGYVSNQAIHAVDWLPTLAGAAGVSLPQDLPLDGINLWPMLSGNEEPKPRTMIHVLDE-VFG 390
            :.....|.::....:|..||:....|..||:|..:||.||.|:|.       :..:|...| :|.
 Frog   305 VISPNTVCDEPTSLMDIFPTVIQLGGGELPRDRIIDGRNLMPLLK-------KQALHSEHEFLFH 362

  Fly   391 Y-SSYMRDTLKYVNGSSFKGRYDQWLGELETNEDDPLGESYEQHVLASDVQSLLGNRGLTKDRIR 454
            | .|::...              :|       .:...|..::.|.: :.|.|..|..|....:: 
 Frog   363 YCGSHLHAV--------------RW-------HEKESGTVWKAHFI-TPVFSPEGAGGCYDFKV- 404

  Fly   455 QMRSEATETCP----PIEGQNPLESHFKCEPLKAPCFFDLAKDPCE----RYNLAQMYPLQLQQL 511
                     ||    .:...||            |..||::.||.|    :.:|...|...:.::
 Frog   405 ---------CPCNGDRVTYHNP------------PLLFDISTDPSESSPLQLHLKPQYMQAINRI 448

  Fly   512 ADELEQIRKTAIPSARVPHSDSRANPTFHNGNWEWWNNTDTQSGSGTF-------SINL 563
            ...:|:.::|..|   ||...|     ..|..|..|    .|...|||       .|||
 Frog   449 KHAIEEHQRTISP---VPQQLS-----LTNNFWNPW----LQPCCGTFPFCWCDKDINL 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 104/459 (23%)
4-S 28..436 CDD:293753 100/436 (23%)
arsdNP_001015952.1 ALP_like 1..468 CDD:304875 122/547 (22%)
AslA 1..445 CDD:225661 116/516 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87962966
eggNOG 1 0.900 E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.