DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7402 and Arsi

Sequence 1:NP_649023.1 Gene:CG7402 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_001033588.1 Gene:Arsi MGIID:2670959 Length:573 Species:Mus musculus

Alignment Length:584 Identity:196/585 (34%)
Similarity:288/585 (49%) Gaps:92/585 (16%)


  Fly     3 SGKILVLLVVSSILSLAYGSGYSTK----------------------PNIVIILIDDMGMNDVSF 45
            ||..||     |:|||.|.|....|                      |:|:.||.||.|.:||.:
Mouse     5 SGFSLV-----SLLSLGYLSWDWAKPGLVADGPAEAGDQPSVAPPQPPHIIFILTDDQGYHDVGY 64

  Fly    46 HGSNQILTPNIDALAYNGILLNKHYVPNLCTPSRATLLTGKYPIHTGMQHFVIITDEPWGLPQRE 110
            |||: |.||.:|.||..|:.|..:|:..:|||||:.||||:|.||||:||.:|...:|..||..:
Mouse    65 HGSD-IETPTLDRLAAEGVKLENYYIQPICTPSRSQLLTGRYQIHTGLQHSIIRPRQPNCLPLDQ 128

  Fly   111 RLMPEIFRDAGYSTHLVGKWHLGFWRKDLTPTMRGFDHHFGYYNGYIDYYDHQVRMLDRNYSAGL 175
            ..:|:..::||||||:||||||||:||:..||.||||...|...|.:|||.:.  ..|.....|.
Mouse   129 VTLPQKLQEAGYSTHMVGKWHLGFYRKECLPTRRGFDTFLGSLTGNVDYYTYD--NCDGPGVCGF 191

  Fly   176 DFRRDLEPCPEANGTYATEAFTSEAKRIIEQHDKSKPLFMVLSHLAVHTGNEDSPMQAPEEEVAK 240
            |...........:|.|:|..:...|..|:..|:...|||:.::..||||     |:|:|.|.:.:
Mouse   192 DLHEGESVAWGLSGQYSTMLYAQRASHILASHNPQNPLFLYVAFQAVHT-----PLQSPREYLYR 251

  Fly   241 FPHIRDPKRRTYAGMISSLDKSVAQTIGALKDNGMLNNSIILLYSDNGAPTIGIHSNAGSNYPYR 305
            :..:.:..||.||.|::.:|::|.....|||..|..|||:|:..||||..|.    :.|||:|.|
Mouse   252 YRTMGNVARRKYAAMVTCMDEAVRNITWALKRYGFYNNSVIIFSSDNGGQTF----SGGSNWPLR 312

  Fly   306 GQKESPWEGGIRSAGALWSPLLKERGYVSNQAIHAVDWLPTLAGAAGVSLPQDLPLDGINLWPML 370
            |:|.:.||||:|..|.:.|||||::...|...:|..||.|||.|.||.:......|||.::||.:
Mouse   313 GRKGTYWEGGVRGLGFVHSPLLKKKRRTSRALVHITDWYPTLVGLAGGTTSAADGLDGYDVWPAI 377

  Fly   371 SGNEEPKPRT-MIHVLDEVFGYSSYMRDTLKYVNGSSFKGRYDQW---------LGELETNEDDP 425
            | .....||| ::|.:|.::.::.:          .|.:|.:..|         :||.:....||
Mouse   378 S-EGRASPRTEILHNIDPLYNHARH----------GSLEGGFGIWNTAVQAAIRVGEWKLLTGDP 431

  Fly   426 -LGESYEQHVLASDVQSLLGNRGLTKDRIRQMRSEATETCPPIEGQNPLESHFKCEPLKAPCFFD 489
             .|:......|||     ........:|:..:|                         :|...|:
Mouse   432 GYGDWIPPQTLAS-----FPGSWWNLERMASIR-------------------------QAVWLFN 466

  Fly   490 LAKDPCERYNLAQMYPLQLQQLADELEQIRKTAIPSARVPHSDSRANPTFHNGNWEWWNNTDTQ 553
            ::.||.||.:||...|..::.|...|....:|||| .|.|.::.||:|.|:.|.|..|.:.:.:
Mouse   467 ISADPYEREDLAGQRPDVVRTLLARLADYNRTAIP-VRYPAANPRAHPDFNGGAWGPWASEEEE 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 162/467 (35%)
4-S 28..436 CDD:293753 157/419 (37%)
ArsiNP_001033588.1 AslA 47..492 CDD:225661 171/498 (34%)
4-S 47..478 CDD:293753 168/484 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87893268
eggNOG 1 0.900 E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 352 1.000 Inparanoid score I2240
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D375140at33208
OrthoFinder 1 1.000 FOG0000498
OrthoInspector 1 1.000 T130985
orthoMCL 1 0.900 OOG5_126989
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.957 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.660

Return to query results.
Submit another query.