DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7402 and ARSI

Sequence 1:NP_649023.1 Gene:CG7402 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_001012301.1 Gene:ARSI HGNCID:32521 Length:569 Species:Homo sapiens

Alignment Length:537 Identity:184/538 (34%)
Similarity:275/538 (51%) Gaps:65/538 (12%)


  Fly    28 PNIVIILIDDMGMNDVSFHGSNQILTPNIDALAYNGILLNKHYVPNLCTPSRATLLTGKYPIHTG 92
            |:|:.||.||.|.:||.:|||: |.||.:|.||..|:.|..:|:..:|||||:.||||:|.||||
Human    47 PHIIFILTDDQGYHDVGYHGSD-IETPTLDRLAAKGVKLENYYIQPICTPSRSQLLTGRYQIHTG 110

  Fly    93 MQHFVIITDEPWGLPQRERLMPEIFRDAGYSTHLVGKWHLGFWRKDLTPTMRGFDHHFGYYNGYI 157
            :||.:|...:|..||..:..:|:..::||||||:||||||||:||:..||.||||...|...|.:
Human   111 LQHSIIRPQQPNCLPLDQVTLPQKLQEAGYSTHMVGKWHLGFYRKECLPTRRGFDTFLGSLTGNV 175

  Fly   158 DYYDHQVRMLDRNYSAGLDFRRDLEPCPEANGTYATEAFTSEAKRIIEQHDKSKPLFMVLSHLAV 222
            |||.:.  ..|.....|.|...........:|.|:|..:...|..|:..|...:|||:.::..||
Human   176 DYYTYD--NCDGPGVCGFDLHEGENVAWGLSGQYSTMLYAQRASHILASHSPQRPLFLYVAFQAV 238

  Fly   223 HTGNEDSPMQAPEEEVAKFPHIRDPKRRTYAGMISSLDKSVAQTIGALKDNGMLNNSIILLYSDN 287
            ||     |:|:|.|.:.::..:.:..||.||.|::.:|::|.....|||..|..|||:|:..|||
Human   239 HT-----PLQSPREYLYRYRTMGNVARRKYAAMVTCMDEAVRNITWALKRYGFYNNSVIIFSSDN 298

  Fly   288 GAPTIGIHSNAGSNYPYRGQKESPWEGGIRSAGALWSPLLKERGYVSNQAIHAVDWLPTLAGAAG 352
            |..|.    :.|||:|.||:|.:.||||:|..|.:.|||||.:...|...:|..||.|||.|.||
Human   299 GGQTF----SGGSNWPLRGRKGTYWEGGVRGLGFVHSPLLKRKQRTSRALMHITDWYPTLVGLAG 359

  Fly   353 VSLPQDLPLDGINLWPMLSGNEEPKPRT-MIHVLDEVFGYSSYMRDTLKYVNGSSFKGRYDQW-- 414
            .:......|||.::||.:| .....||| ::|.:|.::.::.:          .|.:|.:..|  
Human   360 GTTSAADGLDGYDVWPAIS-EGRASPRTEILHNIDPLYNHAQH----------GSLEGGFGIWNT 413

  Fly   415 -------LGELETNEDDP-LGESYEQHVLASDVQSLLGNRGLTKDRIRQMRSEATETCPPIEGQN 471
                   :||.:....|| .|:......||:     ........:|:..:|              
Human   414 AVQAAIRVGEWKLLTGDPGYGDWIPPQTLAT-----FPGSWWNLERMASVR-------------- 459

  Fly   472 PLESHFKCEPLKAPCFFDLAKDPCERYNLAQMYPLQLQQLADELEQIRKTAIPSARVPHSDSRAN 536
                       :|...|:::.||.||.:||...|..::.|...|.:..:|||| .|.|..:.||:
Human   460 -----------QAVWLFNISADPYEREDLAGQRPDVVRTLLARLAEYNRTAIP-VRYPAENPRAH 512

  Fly   537 PTFHNGNWEWWNNTDTQ 553
            |.|:.|.|..|.:.:.:
Human   513 PDFNGGAWGPWASDEEE 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 160/442 (36%)
4-S 28..436 CDD:293753 157/419 (37%)
ARSINP_001012301.1 4-S 48..478 CDD:293753 166/483 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87894508
eggNOG 1 0.900 E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 350 1.000 Inparanoid score I2247
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D375140at33208
OrthoFinder 1 1.000 FOG0000498
OrthoInspector 1 1.000 T130217
orthoMCL 1 0.900 OOG5_126989
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.957 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.660

Return to query results.
Submit another query.