DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7402 and ids

Sequence 1:NP_649023.1 Gene:CG7402 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_001184061.1 Gene:ids XenbaseID:XB-GENE-972154 Length:542 Species:Xenopus tropicalis

Alignment Length:498 Identity:111/499 (22%)
Similarity:183/499 (37%) Gaps:149/499 (30%)


  Fly    29 NIVIILIDDMGMNDVSFHGSNQILTPNIDALAYNGILLNKHYVPN-LCTPSRATLLTGKYPIHTG 92
            |::||:.||: ...:..:|.:.:.:||||.||...|:....|... :|.|||.:.|||:.|..|.
 Frog    35 NVLIIIADDL-RTSLGCYGDSAVKSPNIDHLASQSIIFTNAYAQQAVCAPSRVSFLTGRRPDTTR 98

  Fly    93 MQHFVIITDEPWGL-PQRERLMPEIFRDAGYSTHLVGK-WHLGFWRKDLTPTMRGFDHHFGY--- 152
            :..|    :..|.. ......:|:.|::.||.|..||| :|.|.      .:....|:.:.:   
 Frog    99 LFDF----NSYWRTHAGNYTTLPQYFKEHGYVTMSVGKIFHPGI------SSNHSDDYPYSWSVY 153

  Fly   153 -YNGYIDYYDHQ--VRMLDRNYSAGLDFRRDLEPCPEANGTYATEAFTSEAKRI---IEQHDKSK 211
             |:...:.|::.  .:..|....|.|....|:...||  ||......|.||.|:   ::|.:.| 
 Frog   154 PYHPSAEKYENSQTCKGKDGKLHANLVCPVDVSEVPE--GTLPDIQSTEEAIRLLKTVKQQNAS- 215

  Fly   212 PLFMVLSHLAVH--------------------TGNEDSPMQAP------------EEEV----AK 240
             .|:.:.:...|                    ..:.|.|.:.|            .|:|    ..
 Frog   216 -FFLAVGYHKPHIPFRFPKEFLKLYPIENISLAPDPDIPKKLPLVAYNPWTDIRKREDVQALNIS 279

  Fly   241 FPHIRDPK------RRTYAGMISSLDKSVAQTIGALKDNGMLNNSIILLYSDNGAPTIGIHSNAG 299
            ||:...|:      |::|...:|.||..:.|.:.|::|.|:.|::||:..||:|. ::|.|....
 Frog   280 FPYGPIPEHFQLLIRQSYYASVSYLDDQIGQLLNAVEDLGLSNDTIIVFSSDHGW-SLGEHGEWA 343

  Fly   300 --SNY----------------------------PYRGQKESPWEGGIRSAGALWSPLLKERGYVS 334
              ||:                            |:....:..:.|             |.|.|  
 Frog   344 KYSNFDVTTRVPLIFYVPGMTNIPQQPIFQYIDPFSTNLQRKFPG-------------KSREY-- 393

  Fly   335 NQAIHAVDWLPTLAGAAGVSLPQDLPLDGINLWPMLSGNEEPKPRTMIHVL--------DEVF-- 389
              .:..|....|:|..|.:..|...|....::.....|      |:::|.|        |.|.  
 Frog   394 --PVELVSLFSTIADLAKLPAPPACPQPSFHMELCTEG------RSLVHQLHASENTHDDAVLAV 450

  Fly   390 GYSSYMRDT-----------LKYVN--GSSFKG---RYDQWLG 416
            .||||.|.:           ||.:.  |.|.:.   ||..|:|
 Frog   451 AYSSYPRPSDFPQWNSDLPDLKDIKIMGYSMRTMDYRYTVWVG 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 111/499 (22%)
4-S 28..436 CDD:293753 111/499 (22%)
idsNP_001184061.1 iduronate-2-sulfatase 34..526 CDD:293754 111/499 (22%)
AslA 35..455 CDD:225661 101/459 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.