DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16775 and CG31086

DIOPT Version :9

Sequence 1:NP_649022.2 Gene:CG16775 / 39993 FlyBaseID:FBgn0036767 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001247312.1 Gene:CG31086 / 43179 FlyBaseID:FBgn0051086 Length:148 Species:Drosophila melanogaster


Alignment Length:143 Identity:41/143 - (28%)
Similarity:71/143 - (49%) Gaps:5/143 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WVYLDKTLDLPEEAILGGVDPDGYYTYVGRVTYSSNILPARVVPELGKATYNTDTLGNQATTYEV 96
            |::..... :|:.|::.|.|.||...::||..|.:::|||:::|..|||.........:...|||
  Fly     6 WLHFSNGA-IPQAAVVAGHDSDGDTIFIGRAFYCNDMLPAKIIPNKGKAYVAYANQEVELENYEV 69

  Fly    97 LVSNATVGYHWIRSFDGFREKNAVSVGTNALSERVFICRVRCDESIFIGTLYLSKRMCIVKYDNF 161
            |   :...|.|:.:.:|.....||.||.|...|.::..|.....|:.:|.::.|.....:.||:.
  Fly    70 L---SGFNYEWLPAENGEVPPGAVKVGQNVDGETLYAGRGYHAGSLTVGKVHPSHGCLYIPYDSE 131

  Fly   162 PLRQFDKYEILVR 174
            .::.| .||:|.|
  Fly   132 EVKIF-AYEVLSR 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16775NP_649022.2 DM9 29..100 CDD:128937 21/67 (31%)
DUF3421 51..164 CDD:288732 32/112 (29%)
DM9 104..175 CDD:128937 20/71 (28%)
CG31086NP_001247312.1 DM9 3..73 CDD:128937 21/70 (30%)
DUF3421 24..134 CDD:288732 32/112 (29%)
DM9 74..143 CDD:128937 19/69 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449336
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.