DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16775 and CG31086

DIOPT Version :10

Sequence 1:NP_649022.2 Gene:CG16775 / 39993 FlyBaseID:FBgn0036767 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_733139.1 Gene:CG31086 / 43179 FlyBaseID:FBgn0051086 Length:148 Species:Drosophila melanogaster


Alignment Length:143 Identity:41/143 - (28%)
Similarity:71/143 - (49%) Gaps:5/143 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WVYLDKTLDLPEEAILGGVDPDGYYTYVGRVTYSSNILPARVVPELGKATYNTDTLGNQATTYEV 96
            |::..... :|:.|::.|.|.||...::||..|.:::|||:::|..|||.........:...|||
  Fly     6 WLHFSNGA-IPQAAVVAGHDSDGDTIFIGRAFYCNDMLPAKIIPNKGKAYVAYANQEVELENYEV 69

  Fly    97 LVSNATVGYHWIRSFDGFREKNAVSVGTNALSERVFICRVRCDESIFIGTLYLSKRMCIVKYDNF 161
            |   :...|.|:.:.:|.....||.||.|...|.::..|.....|:.:|.::.|.....:.||:.
  Fly    70 L---SGFNYEWLPAENGEVPPGAVKVGQNVDGETLYAGRGYHAGSLTVGKVHPSHGCLYIPYDSE 131

  Fly   162 PLRQFDKYEILVR 174
            .::.| .||:|.|
  Fly   132 EVKIF-AYEVLSR 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16775NP_649022.2 DUF3421 52..164 CDD:463390 31/111 (28%)
CG31086NP_733139.1 DUF3421 25..135 CDD:463390 31/112 (28%)

Return to query results.
Submit another query.