DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16775 and traip

Sequence 1:NP_649022.2 Gene:CG16775 FlyBaseID:FBgn0036767 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_991170.1 Gene:traip ZFINID:ZDB-GENE-040801-30 Length:453 Species:Danio rerio

Alignment Length:95 Identity:22/96 (23%)
Similarity:32/96 (33%) Gaps:38/96 (40%)


  Fly    25 VYSYEDKWVYLDKTLDLP---EEAILGGV---------DPDGYYTYVGRVTYSSNI--------- 68
            :.|.:.|...|.:||..|   .|||...|         .|.|:    |.:|.|..|         
Zfish   265 ITSLKKKVEILQRTLSTPTRTNEAISRLVFESPAPLELKPPGH----GHMTDSQEIDLNLTFDIN 325

  Fly    69 -----------LP--ARVVPELGKATYNTD 85
                       :|  .|:.|.:..:|.||:
Zfish   326 TPEHVEKKPVQVPKKMRLDPSVSSSTQNTE 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16775NP_649022.2 DM9 29..100 CDD:128937 21/92 (23%)
DUF3421 51..164 CDD:288732 12/58 (21%)
DM9 104..175 CDD:128937
traipNP_991170.1 zf-RING_2 7..50 CDD:290367
Prefoldin 136..256 CDD:298833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001331
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.