DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16775 and CG10527

DIOPT Version :10

Sequence 1:NP_649022.2 Gene:CG16775 / 39993 FlyBaseID:FBgn0036767 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_611544.1 Gene:CG10527 / 37393 FlyBaseID:FBgn0034583 Length:296 Species:Drosophila melanogaster


Alignment Length:135 Identity:38/135 - (28%)
Similarity:59/135 - (43%) Gaps:7/135 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DLPEEAILGGVDPDGYYTYVGRVTYSSNILPARVVPELGKATYNTDTLGNQA-TTYEVLVSNATV 103
            ::|..|:.||.| .....|:.|..:..:::|.::.|..| .||.....|... ..||||.:.   
  Fly   166 EVPPNALEGGFD-SSEQLYIARARHEGDLIPGKLHPSHG-VTYVAWGGGEHGHAEYEVLCAG--- 225

  Fly   104 GYHWIRSFDGFREKNAVSVGTNALSERVFICRVRCDESIFIGTLYLSKRMCIVKYDNFPLRQFDK 168
            |..|:....|....||:..|..|..|.:||.|...|.:|.:|.:..|...|.:.|....| .:.:
  Fly   226 GGQWLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEEL-AYKE 289

  Fly   169 YEILV 173
            :||.|
  Fly   290 FEIYV 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16775NP_649022.2 DUF3421 52..164 CDD:463390 29/112 (26%)
CG10527NP_611544.1 Methyltransf_FA 34..132 CDD:463505
DUF3421 177..287 CDD:463390 31/115 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.