DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16775 and CG10527

Sequence 1:NP_649022.2 Gene:CG16775 FlyBaseID:FBgn0036767 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_611544.1 Gene:CG10527 FlyBaseID:FBgn0034583 Length:296 Species:Drosophila melanogaster

Alignment Length:135 Identity:38/136 (28%)
Similarity:59/136 (43%) Gaps:7/136 (5%)


  Fly    40 DLPEEAILGGVDPDGYYTYVGRVTYSSNILPARVVPELGKATYNTDTLGNQA-TTYEVLVSNATV 103
            ::|..|:.||.| .....|:.|..:..:::|.::.|..| .||.....|... ..||||.:.   
  Fly   166 EVPPNALEGGFD-SSEQLYIARARHEGDLIPGKLHPSHG-VTYVAWGGGEHGHAEYEVLCAG--- 225

  Fly   104 GYHWIRSFDGFREKNAVSVGTNALSERVFICRVRCDESIFIGTLYLSKRMCIVKYDNFPLRQFDK 168
            |..|:....|....||:..|..|..|.:||.|...|.:|.:|.:..|...|.:.|....| .:.:
  Fly   226 GGQWLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEEL-AYKE 289

  Fly   169 YEILV 173
            :||.|
  Fly   290 FEIYV 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16775NP_649022.2 DM9 29..100 CDD:128937 17/61 (28%)
DUF3421 51..164 CDD:288732 31/114 (27%)
DM9 104..175 CDD:128937 21/71 (30%)
CG10527NP_611544.1 Methyltransf_FA 35..133 CDD:289052
DM9 156..225 CDD:128937 17/61 (28%)
DUF3421 180..286 CDD:288732 30/111 (27%)
DM9 226..296 CDD:128937 21/71 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131156251
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001331
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR31649
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.