DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16775 and nopo

Sequence 1:NP_649022.2 Gene:CG16775 FlyBaseID:FBgn0036767 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_611305.1 Gene:nopo FlyBaseID:FBgn0034314 Length:435 Species:Drosophila melanogaster

Alignment Length:30 Identity:8/31 (26%)
Similarity:15/31 (48%) Gaps:7/31 (23%)


  Fly    14 LVQMVAQIHGGVY-------SYEDKWVYLD 36
            |.:.|:.:...:|       ::|:|..|||
  Fly   231 LEERVSHLESDLYQAQEKLQAFENKTAYLD 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16775NP_649022.2 DM9 29..100 CDD:128937 5/9 (56%)
DUF3421 51..164 CDD:288732
DM9 104..175 CDD:128937
nopoNP_611305.1 zf-RING_2 5..47 CDD:290367
zf-rbx1 <5..47 CDD:289448
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001331
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.