DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16775 and CG10916

Sequence 1:NP_649022.2 Gene:CG16775 FlyBaseID:FBgn0036767 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001261070.1 Gene:CG10916 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster

Alignment Length:151 Identity:42/152 (28%)
Similarity:70/152 (46%) Gaps:12/152 (8%)


  Fly    32 WVYLDKTLDL-------PEEAILGGVDPDGYYTYVGRVTYSSNILPARVVPELGKATYNTDTLGN 89
            ||.:|...|.       ||.|:..|.:.||..|||.|..|..::|||..||| .||.:.:.:...
  Fly   107 WVPIDLDRDSLPDAHLPPEGAVQCGTNEDGLPTYVARGYYHDDLLPAPYVPE-KKAAFGSHSCSA 170

  Fly    90 QATT--YEVLVSNATVGYHWIRSFDGFREKNAVSVGTNALSERVFICRVRCDESIFIGTLYLSKR 152
            :..|  .|:||.| ...|.|:....|...::|::.|.:.|.|..:..|......:.:|.::.|.:
  Fly   171 RTLTDDVEILVLN-DCDYKWVPGQHGTYPRDALNTGYSELGEVTYTGRGLYQGILRLGKVHPSHK 234

  Fly   153 MCIVKYDNFPLRQFDKYEILV 173
            :..:.:....: ..:.||:||
  Fly   235 VMYIPHHGQEV-SVNTYEVLV 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16775NP_649022.2 DM9 29..100 CDD:128937 27/77 (35%)
DUF3421 51..164 CDD:288732 30/115 (26%)
DM9 104..175 CDD:128937 14/71 (20%)
CG10916NP_001261070.1 zf-RING_2 32..74 CDD:290367
zf-rbx1 <32..74 CDD:289448
DM9 105..183 CDD:128937 27/77 (35%)
DUF3421 133..246 CDD:288732 30/116 (26%)
DM9 186..254 CDD:128937 13/69 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131155913
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001331
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR31649
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.