DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16775 and CG13321

Sequence 1:NP_649022.2 Gene:CG16775 FlyBaseID:FBgn0036767 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001286367.1 Gene:CG13321 FlyBaseID:FBgn0033787 Length:286 Species:Drosophila melanogaster

Alignment Length:133 Identity:44/134 (33%)
Similarity:64/134 (48%) Gaps:12/134 (9%)


  Fly    46 ILGGVDPDGYYTYVGRVTYSSNILPARVVPELGKA--TYNTDTLGNQAT--TYEVLVSNATVGYH 106
            ::||.|.||...||||..:..::|||:|:|..|.|  .|.    |.:..  .||:|   |..||.
  Fly   161 VVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYG----GGEVVKHDYELL---AGYGYG 218

  Fly   107 WIRSFDGFREKNAVSVGTNALSERVFICRVRCDESIFIGTLYLSKRMCIVKYDNFPLRQFDKYEI 171
            |:....|....|||..|..:..|.:||.|.....|:..|.::.|.....:.:|...:| .|.||:
  Fly   219 WVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVR-IDHYEV 282

  Fly   172 LVR 174
            ||:
  Fly   283 LVK 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16775NP_649022.2 DM9 29..100 CDD:128937 21/58 (36%)
DUF3421 51..164 CDD:288732 36/117 (31%)
DM9 104..175 CDD:128937 22/72 (31%)
CG13321NP_001286367.1 DM9 3..73 CDD:128937
DUF3421 25..135 CDD:288732
DM9 75..143 CDD:128937
DM9 147..215 CDD:128937 22/61 (36%)
DUF3421 166..276 CDD:288732 36/117 (31%)
DM9 216..286 CDD:128937 22/72 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131156043
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001331
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR31649
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.