DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16775 and CG32633

DIOPT Version :10

Sequence 1:NP_649022.2 Gene:CG16775 / 39993 FlyBaseID:FBgn0036767 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_572898.1 Gene:CG32633 / 326225 FlyBaseID:FBgn0052633 Length:285 Species:Drosophila melanogaster


Alignment Length:156 Identity:46/156 - (29%)
Similarity:83/156 - (53%) Gaps:12/156 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VYSYE-----DKWVYLDKTLDLPEEAILGGVDPDGYYTYVGRVTYSSNILPARVVPELGKATYNT 84
            :::||     ::|:....| ::|:.|::.|.|.:|...|||||..:.::|||:|||..|||....
  Fly   135 IFAYEVLCQPERWIDTTAT-NIPDGALVAGHDSNGDTIYVGRVFRNGDLLPAKVVPAKGKAYAAY 198

  Fly    85 DTLGNQATTYEVLVSNATVGYHWIRSFDGFREKNAVSVGTNALSERVFICR-VRCDESIFIGTLY 148
            ....::.|..:||..:   |:.|:.:..|.....|:|.|.|...|.:::.| :.|| |:.:|.::
  Fly   199 AQAEHELTDVQVLTGS---GFRWVPASHGNVAPGALSSGPNVDGEPLYVGRAIYCD-SLSVGKIH 259

  Fly   149 LSKRMCIVKYDNFPLRQFDKYEILVR 174
            .|.....:.:....:| .:.||:|||
  Fly   260 PSHGCIYIPFGGEEVR-LENYEVLVR 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16775NP_649022.2 DUF3421 52..164 CDD:463390 32/112 (29%)
CG32633NP_572898.1 DUF3421 25..135 CDD:463390 46/156 (29%)
DUF3421 166..275 CDD:463390 32/112 (29%)

Return to query results.
Submit another query.