powered by:
                  
 
    
 
    
             
          
            Protein Alignment CG16775 and CG44250
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_649022.2 | 
            Gene: | CG16775 / 39993 | 
            FlyBaseID: | FBgn0036767 | 
            Length: | 191 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_001163133.1 | 
            Gene: | CG44250 / 19836034 | 
            FlyBaseID: | FBgn0265185 | 
            Length: | 297 | 
            Species: | Drosophila melanogaster | 
          
        
        
        
          
            | Alignment Length: | 155 | 
            Identity: | 49/155 - (31%) | 
          
          
            | Similarity: | 76/155 -  (49%) | 
            Gaps: | 4/155 - (2%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly    23 GGVYSYEDKWVYLDKTLDLPEEAILGGVDPDGYYTYVGRVTYSSNILPARVVPELGKATYNTDTL 87 
            |||.:.::.||:......||..|::||.|.|....||||..:....|||:|||..|.|....... 
  Fly     7 GGVVTVDNTWVHSSPYSPLPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGA 71 
 
  Fly    88 GNQATTYEVLVSNATVGYHWIRSFDGFREKNAVSVGTNALSERVFICRVRCDESIFIGTLYLSKR 152 
            .:..|.|||||..   |:.|:.|..|....|||..||....|.:::.|.....|:.:|.::.|.. 
  Fly    72 EHTKTHYEVLVGQ---GFAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHG 133 
 
  Fly   153 MCIVKYDNFPLRQFDKYEILVRERH 177 
            ...:.:....:| .:.||:|::::| 
  Fly   134 CLYIPFGGQEVR-INTYEVLIKQQH 157 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            1 | 
            0.930 | 
            - | 
            - | 
             | 
            C45449334 | 
          
          
            | Domainoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | eggNOG | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Isobase | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoFinder | 
            1 | 
            1.000 | 
            - | 
            - | 
             | 
            FOG0005929 | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            1 | 
            1.100 | 
            - | 
            - | 
            P | 
            PTHR31649 | 
          
          
            | Phylome | 
            1 | 
            0.910 | 
            - | 
            - | 
             | 
             | 
          
          
            | RoundUp | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            4 | 3.940 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.