DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16775 and CG44250

DIOPT Version :10

Sequence 1:NP_649022.2 Gene:CG16775 / 39993 FlyBaseID:FBgn0036767 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001163133.1 Gene:CG44250 / 19836034 FlyBaseID:FBgn0265185 Length:297 Species:Drosophila melanogaster


Alignment Length:155 Identity:49/155 - (31%)
Similarity:76/155 - (49%) Gaps:4/155 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GGVYSYEDKWVYLDKTLDLPEEAILGGVDPDGYYTYVGRVTYSSNILPARVVPELGKATYNTDTL 87
            |||.:.::.||:......||..|::||.|.|....||||..:....|||:|||..|.|.......
  Fly     7 GGVVTVDNTWVHSSPYSPLPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGA 71

  Fly    88 GNQATTYEVLVSNATVGYHWIRSFDGFREKNAVSVGTNALSERVFICRVRCDESIFIGTLYLSKR 152
            .:..|.|||||..   |:.|:.|..|....|||..||....|.:::.|.....|:.:|.::.|..
  Fly    72 EHTKTHYEVLVGQ---GFAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHG 133

  Fly   153 MCIVKYDNFPLRQFDKYEILVRERH 177
            ...:.:....:| .:.||:|::::|
  Fly   134 CLYIPFGGQEVR-INTYEVLIKQQH 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16775NP_649022.2 DUF3421 52..164 CDD:463390 33/111 (30%)
CG44250NP_001163133.1 DUF3421 36..146 CDD:463390 34/113 (30%)
DUF3421 179..288 CDD:463390
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.