DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16775 and CG44250

DIOPT Version :9

Sequence 1:NP_649022.2 Gene:CG16775 / 39993 FlyBaseID:FBgn0036767 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001163133.1 Gene:CG44250 / 19836034 FlyBaseID:FBgn0265185 Length:297 Species:Drosophila melanogaster


Alignment Length:155 Identity:49/155 - (31%)
Similarity:76/155 - (49%) Gaps:4/155 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GGVYSYEDKWVYLDKTLDLPEEAILGGVDPDGYYTYVGRVTYSSNILPARVVPELGKATYNTDTL 87
            |||.:.::.||:......||..|::||.|.|....||||..:....|||:|||..|.|.......
  Fly     7 GGVVTVDNTWVHSSPYSPLPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGA 71

  Fly    88 GNQATTYEVLVSNATVGYHWIRSFDGFREKNAVSVGTNALSERVFICRVRCDESIFIGTLYLSKR 152
            .:..|.|||||..   |:.|:.|..|....|||..||....|.:::.|.....|:.:|.::.|..
  Fly    72 EHTKTHYEVLVGQ---GFAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHG 133

  Fly   153 MCIVKYDNFPLRQFDKYEILVRERH 177
            ...:.:....:| .:.||:|::::|
  Fly   134 CLYIPFGGQEVR-INTYEVLIKQQH 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16775NP_649022.2 DM9 29..100 CDD:128937 27/70 (39%)
DUF3421 51..164 CDD:288732 34/112 (30%)
DM9 104..175 CDD:128937 18/70 (26%)
CG44250NP_001163133.1 DM9 13..84 CDD:128937 27/70 (39%)
DUF3421 35..145 CDD:288732 34/112 (30%)
DM9 85..155 CDD:128937 18/70 (26%)
DM9 157..227 CDD:128937 1/1 (100%)
DUF3421 178..287 CDD:288732
DM9 228..297 CDD:128937
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449334
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.