DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6034 and CG5653

Sequence 1:NP_649005.1 Gene:CG6034 FlyBaseID:FBgn0036750 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_648269.1 Gene:CG5653 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster

Alignment Length:472 Identity:228/473 (48%)
Similarity:316/473 (67%) Gaps:15/473 (3%)


  Fly    12 KTKETAKIVIIGAGASGVAAATKLLEQGFKNVLLFEAEDRIGGRINTILFANSLIDLGAQWCHGE 76
            |.:.:::|:|||||.||:||||:||:..|:||.:.||||||||||||:.|.:::||||||||||:
  Fly     3 KCRASSRIIIIGAGVSGIAAATRLLQNNFQNVQILEAEDRIGGRINTVYFGDNVIDLGAQWCHGK 67

  Fly    77 EGNVVYEKVKDLDVLDRTGDYV--VHFIRSNKEILTD-----VHNKALTELTNAFEVPGEHE--G 132
            :.|.||:.|||:.:|..||||.  :..:|||||::..     :|:.|:..:.:     |.|.  |
  Fly    68 QQNCVYDMVKDMGILHETGDYYSPIKRVRSNKEVVPHELACRIHDIAVKSMPS-----GPHPVVG 127

  Fly   133 SVGDAF-NAYWKENIHQLVPNDKTIAKEAQDCLKKVICSMDACDNLSELSYRNFRNFAIAGGDQN 196
            |.|... ..:|::...:|...::.:|.||.:...|...|:...|||.|:|.|....:....||:.
  Fly   128 SFGTHLTQTFWRKIESELPQVNRDVASEALNTFAKHESSIIGADNLFEVSVREHIEYHECDGDKL 192

  Fly   197 LSWRQKGYWKFLSVLLNSSDNQPGDQGILKGHVHLNKRIAKINWEGDGELTLRCWNGQFVSADHV 261
            |.|..|||.:||.:|:..|.:.|.:.|:|:|.:.|:.::.||......::.|||.:|.:..||||
  Fly   193 LHWGTKGYRRFLRLLMKVSADTPEELGLLEGRIQLDMKVIKIELACPRKVILRCQDGDYFEADHV 257

  Fly   262 ICTVSLGVLREKHHKLFVPALPASKIRSIEGLKLGTVNKFYLEFEEQPVPENIREMAFLWLEEDL 326
            |||||||||:|:|.|||||.|||:|:.:|..|.||||||.|||:|:||:|:........||||||
  Fly   258 ICTVSLGVLQEQHEKLFVPPLPAAKVNAIRSLTLGTVNKLYLEYEKQPLPDGWVGFFCFWLEEDL 322

  Fly   327 KELRSGKYFWLESVCYFHRVDCQPRLLQGWIIGAHSRYVETISEEQVLEGIMWMFRKFLKFSVPY 391
            .|||..:|||:|.:...|.:.||||:|..|:.|.|.|::||:|:|:||||:.|:|||||.|.:|.
  Fly   323 IELRKTEYFWVEGITGVHMITCQPRMLMAWVNGPHGRHMETLSDEKVLEGLYWLFRKFLTFEIPP 387

  Fly   392 PKNFLRSQWQSNPNFRGSYSYYSTYADELRTGRTDLASPLVDVTGRPRIQFAGEASSRNHFSTVH 456
            ||.|:||.|.||||||||:||....|||..||..||.||::...|...:.|||||||||||||||
  Fly   388 PKRFVRSSWFSNPNFRGSWSYRGVMADERNTGPWDLESPVLGEDGHLGLLFAGEASSRNHFSTVH 452

  Fly   457 GAIESGWREAERLNEFY 473
            ||:|:|:|||:||.:.|
  Fly   453 GAVEAGYREADRLIDHY 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6034NP_649005.1 Amino_oxidase 33..470 CDD:279874 215/447 (48%)
NAD_binding_8 <35..88 CDD:290186 34/53 (64%)
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 44/66 (67%)
Amino_oxidase 17..466 CDD:279874 220/454 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130815266
eggNOG 1 0.900 E1_KOG0685
Homologene 1 1.000 H77187
Inparanoid 1 1.050 177 1.000 Inparanoid score I1436
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D375579at33208
OrthoFinder 1 1.000 FOG0000545
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10742
RoundUp 00.000 Not matched by this tool.
76.990

Return to query results.
Submit another query.