DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7460 and CG5653

Sequence 1:NP_001261998.1 Gene:CG7460 FlyBaseID:FBgn0036749 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_648269.1 Gene:CG5653 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster

Alignment Length:472 Identity:245/473 (52%)
Similarity:337/473 (71%) Gaps:4/473 (1%)


  Fly     9 LSKTRQTARIVIVGAGSAGIAAATRLLDLGFRNVLLLEAEDRIGGRVHTIPFADNVVDLGAQWCH 73
            :.|.|.::||:|:|||.:|||||||||...|:||.:||||||||||::|:.|.|||:||||||||
  Fly     1 MEKCRASSRIIIIGAGVSGIAAATRLLQNNFQNVQILEAEDRIGGRINTVYFGDNVIDLGAQWCH 65

  Fly    74 GEKGNVVYDKVKDLNLLEVTEPHYETFRCVRSNKEVLPDDLADQLKTIADMSIPDRQAELLDFEG 138
            |::.|.|||.|||:.:|..|..:|...:.|||||||:|.:||.::..||..|:|.....::   |
  Fly    66 GKQQNCVYDMVKDMGILHETGDYYSPIKRVRSNKEVVPHELACRIHDIAVKSMPSGPHPVV---G 127

  Fly   139 SLGDYINMKYWKEL-AKLPPIDRTIAEEFLEVFHKFEASVEAADHLFEVSGKGHLEYWLCEGELL 202
            |.|.::...:|::: ::||.::|.:|.|.|..|.|.|:|:..||:|||||.:.|:||..|:|:.|
  Fly   128 SFGTHLTQTFWRKIESELPQVNRDVASEALNTFAKHESSIIGADNLFEVSVREHIEYHECDGDKL 192

  Fly   203 LNWKDKGYKRFLKLLMKAPEDQSEDLGILKDHVRLNRRIAEINWKGADELTVRCWNGEVITADHV 267
            |:|..|||:|||:||||...|..|:||:|:..::|:.::.:|......::.:||.:|:...||||
  Fly   193 LHWGTKGYRRFLRLLMKVSADTPEELGLLEGRIQLDMKVIKIELACPRKVILRCQDGDYFEADHV 257

  Fly   268 ICTVSLGVLKEQHPKLFVPALPAAKVRAIEGLKLGTVDKFFLEFENPPLPGDWPGFNCLWLKEDL 332
            |||||||||:|||.|||||.||||||.||..|.||||:|.:||:|..|||..|.||.|.||:|||
  Fly   258 ICTVSLGVLQEQHEKLFVPPLPAAKVNAIRSLTLGTVNKLYLEYEKQPLPDGWVGFFCFWLEEDL 322

  Fly   333 EELRASELFWLESVFGFYPVSRQPRILQGWIIGPHARHMETLTEERVLEGLLWLFRKFLPFETAH 397
            .|||.:|.||:|.:.|.:.::.|||:|..|:.|||.||||||::|:|||||.|||||||.||...
  Fly   323 IELRKTEYFWVEGITGVHMITCQPRMLMAWVNGPHGRHMETLSDEKVLEGLYWLFRKFLTFEIPP 387

  Fly   398 PVRMLRTQWHANPNFRGSYTFRSTYTDALRTGAWDLEAPLQDVCGRPRLQFAGESTHKHFYSTVH 462
            |.|.:|:.|.:|||||||:::|....|...||.||||:|:....|...|.||||::.::.:||||
  Fly   388 PKRFVRSSWFSNPNFRGSWSYRGVMADERNTGPWDLESPVLGEDGHLGLLFAGEASSRNHFSTVH 452

  Fly   463 GAVETGWREAERLHLYY 479
            ||||.|:|||:||..:|
  Fly   453 GAVEAGYREADRLIDHY 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7460NP_001261998.1 Amino_oxidase 32..476 CDD:279874 231/445 (52%)
NAD_binding_8 33..>74 CDD:290186 29/41 (71%)
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 46/66 (70%)
Amino_oxidase 17..466 CDD:279874 236/452 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130815315
eggNOG 1 0.900 E1_KOG0685
Homologene 1 1.000 H77187
Inparanoid 1 1.050 177 1.000 Inparanoid score I1436
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D375579at33208
OrthoFinder 1 1.000 FOG0000545
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10742
RoundUp 00.000 Not matched by this tool.
76.990

Return to query results.
Submit another query.