DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7484 and AT1G05720

Sequence 1:NP_649000.1 Gene:CG7484 FlyBaseID:FBgn0036745 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_563747.1 Gene:AT1G05720 AraportID:AT1G05720 Length:163 Species:Arabidopsis thaliana

Alignment Length:141 Identity:42/142 (30%)
Similarity:77/142 (54%) Gaps:4/142 (3%)


  Fly     5 AIFLLLALSCQQIQAELTAADCRALGFIKAQLMCSSCEKLDDFGLD-TIKPQCKQCCTLDQQPAA 68
            |:.:|:..|....:.:|:..:|..||| ....:||.|..|.::..| .:...|.:||..|.:.:.
plant    14 AMMILILASTISAKEQLSTKECEDLGF-SGLALCSDCHSLSEYVKDQELVSDCLKCCADDSEDSM 77

  Fly    69 QR-TYAKAILEVCTCKFRAYPQIQAFIQSGRPAKFPNLQIKYVRGLDPVVKLLDASGKVQETLSI 132
            .: ||:.||||||..|...||:|..||:..: .|||:::::|:....|.:.:||..|:.:|::.|
plant    78 SKVTYSGAILEVCMRKLVFYPEIVGFIEEEK-EKFPSVKVQYIFNSPPKLIMLDEDGEHKESIRI 141

  Fly   133 TKWNTDTVEEF 143
            ..|..:.:.::
plant   142 DNWKREHLLQY 152

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7484NP_649000.1 Sep15_SelM 74..148 CDD:285958 23/71 (32%)
AT1G05720NP_563747.1 Sep15_SelM 84..158 CDD:285958 23/71 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H3145
Inparanoid 1 1.050 78 1.000 Inparanoid score I2327
OMA 1 1.010
OrthoDB 1 1.010 D1405992at2759
OrthoInspector 1 1.000 T193440
orthoMCL 1 0.900 OOG5_132726
Panther 1 1.100 LDO PTHR13077
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.