DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7484 and selenof

Sequence 1:NP_649000.1 Gene:CG7484 FlyBaseID:FBgn0036745 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_840079.1 Gene:selenof ZFINID:ZDB-GENE-030327-1 Length:153 Species:Danio rerio

Alignment Length:149 Identity:72/150 (48%)
Similarity:94/150 (63%) Gaps:5/150 (3%)


  Fly     6 IFLLLALSCQQ----IQAELTAADCRALGFIKAQLMCSSCEKLDDFGLDTIKPQCKQCCTLDQQP 66
            ::||..|...|    ..|||::..||.||| .:.|:|||||.|..|.|:.:...|:|||..:.|.
Zfish     5 VYLLWLLPLLQGLASYGAELSSEACRELGF-SSNLLCSSCELLGQFSLNQLDLPCRQCCQEEAQL 68

  Fly    67 AAQRTYAKAILEVCTCKFRAYPQIQAFIQSGRPAKFPNLQIKYVRGLDPVVKLLDASGKVQETLS 131
            ..::.|..||||||..|...:||:|||::|.:|..|..||||||||.|||:||||.:|.:.|.||
Zfish    69 ENRKLYPGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELS 133

  Fly   132 ITKWNTDTVEEFFETHLAK 150
            |.|||||:||||....|.:
Zfish   134 ILKWNTDSVEEFLSEKLER 152

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7484NP_649000.1 Sep15_SelM 74..148 CDD:285958 44/74 (59%)
selenofNP_840079.1 Sep15_SelM 76..151 CDD:285958 45/75 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C271799101
eggNOG 1 0.900 E1_KOG3384
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H3145
Inparanoid 1 1.050 136 1.000 Inparanoid score I4460
OMA 1 1.010
OrthoDB 1 1.010 D1405992at2759
OrthoFinder 1 1.000 FOG0006495
OrthoInspector 1 1.000 T1054230
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13077
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.