DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7484 and Y76B12C.3

Sequence 1:NP_649000.1 Gene:CG7484 FlyBaseID:FBgn0036745 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_500152.1 Gene:Y76B12C.3 WormBaseID:WBGene00022297 Length:152 Species:Caenorhabditis elegans

Alignment Length:149 Identity:58/150 (39%)
Similarity:83/150 (55%) Gaps:7/150 (5%)


  Fly     6 IFLLLALSCQQIQAE-----LTAADCRALGFIKAQLMCSSCEKLDDFGLDTIKPQCKQCCTLDQQ 65
            ||||||.....:..|     :...:|:|.||....|.|..||:|.|:.|:|:...|.||| :.::
 Worm     4 IFLLLAAVVSPMFGEVEEYKIDVEECKAAGFNPETLKCGLCERLSDYHLETLLTDCLQCC-IKEE 67

  Fly    66 PAAQRTYAKAILEVCTCKFRAYPQIQAFIQSGRPAKF-PNLQIKYVRGLDPVVKLLDASGKVQET 129
            ......|..||||||.|....:||:|||:......:| ..:::|:|||:.|.|.|.||..|.:|.
 Worm    68 EFKHEKYPTAILEVCECNLARFPQVQAFVHKDMARQFGGKVKVKHVRGVRPQVALKDADFKTKEV 132

  Fly   130 LSITKWNTDTVEEFFETHL 148
            ||:.||:|||:.:||...|
 Worm   133 LSVEKWDTDTLIDFFNQWL 151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7484NP_649000.1 Sep15_SelM 74..148 CDD:285958 33/75 (44%)
Y76B12C.3NP_500152.1 Sep15_SelM 77..152 CDD:285958 34/76 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C271791040
eggNOG 1 0.900 E1_KOG3384
Hieranoid 1 1.000
Homologene 1 1.000 H3145
Inparanoid 1 1.050 109 1.000 Inparanoid score I3439
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1405992at2759
OrthoFinder 1 1.000 FOG0006495
OrthoInspector 1 1.000 T474309
orthoMCL 1 0.900 OOG5_132726
Panther 1 1.100 LDO PTHR13077
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4291
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.