DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7484 and Y76B12C.3

DIOPT Version :9

Sequence 1:NP_649000.1 Gene:CG7484 / 39969 FlyBaseID:FBgn0036745 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_500152.1 Gene:Y76B12C.3 / 176999 WormBaseID:WBGene00022297 Length:152 Species:Caenorhabditis elegans


Alignment Length:149 Identity:58/149 - (38%)
Similarity:83/149 - (55%) Gaps:7/149 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IFLLLALSCQQIQAE-----LTAADCRALGFIKAQLMCSSCEKLDDFGLDTIKPQCKQCCTLDQQ 65
            ||||||.....:..|     :...:|:|.||....|.|..||:|.|:.|:|:...|.||| :.::
 Worm     4 IFLLLAAVVSPMFGEVEEYKIDVEECKAAGFNPETLKCGLCERLSDYHLETLLTDCLQCC-IKEE 67

  Fly    66 PAAQRTYAKAILEVCTCKFRAYPQIQAFIQSGRPAKF-PNLQIKYVRGLDPVVKLLDASGKVQET 129
            ......|..||||||.|....:||:|||:......:| ..:::|:|||:.|.|.|.||..|.:|.
 Worm    68 EFKHEKYPTAILEVCECNLARFPQVQAFVHKDMARQFGGKVKVKHVRGVRPQVALKDADFKTKEV 132

  Fly   130 LSITKWNTDTVEEFFETHL 148
            ||:.||:|||:.:||...|
 Worm   133 LSVEKWDTDTLIDFFNQWL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7484NP_649000.1 Sep15_SelM 74..148 CDD:285958 33/74 (45%)
Y76B12C.3NP_500152.1 Sep15_SelM 77..149 CDD:370134 33/71 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165170
Domainoid 1 1.000 70 1.000 Domainoid score I6235
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3145
Inparanoid 1 1.050 109 1.000 Inparanoid score I3465
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55610
OrthoDB 1 1.010 - - D1405992at2759
OrthoFinder 1 1.000 - - FOG0006223
OrthoInspector 1 1.000 - - oto19209
orthoMCL 1 0.900 - - OOG6_105650
Panther 1 1.100 - - LDO PTHR13077
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4291
SonicParanoid 1 1.000 - - X5163
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.900

Return to query results.
Submit another query.