DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7484 and Selenof

Sequence 1:NP_649000.1 Gene:CG7484 FlyBaseID:FBgn0036745 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_579831.2 Gene:Selenof RGDID:621291 Length:162 Species:Rattus norvegicus

Alignment Length:146 Identity:72/147 (49%)
Similarity:94/147 (64%) Gaps:4/147 (3%)


  Fly     8 LLLALSCQQIQ---AELTAADCRALGFIKAQLMCSSCEKLDDFGLDTIKPQCKQCCTLDQQPAAQ 69
            ||||.:.|.:.   ||.::..||.||| .:.|:||||:.|..|.|..:.|.|:.||..:.|...:
  Rat    17 LLLATAFQAVSALGAEFSSEACRELGF-SSNLLCSSCDLLGQFNLLPLDPVCRGCCQEEAQFETK 80

  Fly    70 RTYAKAILEVCTCKFRAYPQIQAFIQSGRPAKFPNLQIKYVRGLDPVVKLLDASGKVQETLSITK 134
            :.||.||||||. |...:||:|||::|.:|..|..||||||||.|||:||||.:|.:.|.|||.|
  Rat    81 KLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILK 145

  Fly   135 WNTDTVEEFFETHLAK 150
            ||||:||||....|.:
  Rat   146 WNTDSVEEFLSEKLER 161

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7484NP_649000.1 Sep15_SelM 74..148 CDD:285958 44/74 (59%)
SelenofNP_579831.2 Sep15_SelM 85..160 CDD:312367 45/75 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C271799393
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H3145
Inparanoid 1 1.050 137 1.000 Inparanoid score I4377
OMA 1 1.010
OrthoDB 1 1.010 D1405992at2759
OrthoFinder 1 1.000 FOG0006495
OrthoInspector 1 1.000 T1088616
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13077
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
99.010

Return to query results.
Submit another query.