DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7484 and selenof

Sequence 1:NP_649000.1 Gene:CG7484 FlyBaseID:FBgn0036745 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001165182.1 Gene:selenof XenbaseID:XB-GENE-942787 Length:153 Species:Xenopus tropicalis

Alignment Length:143 Identity:71/144 (49%)
Similarity:94/144 (65%) Gaps:3/144 (2%)


  Fly     6 IFLLLALSCQQIQAELTAADCRALGFIKAQLMCSSCEKLDDFGLDTIKPQCKQCCTLDQQPAAQR 70
            :.:|.|||  ...|||::..||.||| .:.|:|:|||.|..|||:.|...|:|||..:....:::
 Frog    11 VTVLQALS--SYGAELSSEACRDLGF-SSNLLCTSCELLGQFGLNEINLFCRQCCQEEVHLESKK 72

  Fly    71 TYAKAILEVCTCKFRAYPQIQAFIQSGRPAKFPNLQIKYVRGLDPVVKLLDASGKVQETLSITKW 135
            .|..|:||||. |...:||:|||::|.:|..|..||||||||.|||:||||.:|.:.|.|||.||
 Frog    73 RYPGAVLEVCGUKLGRFPQVQAFVRSEKPKLFKGLQIKYVRGSDPVLKLLDENGNISEELSILKW 137

  Fly   136 NTDTVEEFFETHL 148
            |||:||||....|
 Frog   138 NTDSVEEFLSEKL 150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7484NP_649000.1 Sep15_SelM 74..148 CDD:285958 43/74 (58%)
selenofNP_001165182.1 Sep15_SelM 76..150 CDD:285958 43/74 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H3145
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1405992at2759
OrthoFinder 1 1.000 FOG0006495
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.