DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MYO18A and zip

Sequence 1:NP_001333694.1 Gene:MYO18A HGNCID:31104 Length:2058 Species:Homo sapiens
Sequence 2:NP_523860.2 Gene:zip FlyBaseID:FBgn0265434 Length:2056 Species:Drosophila melanogaster

Alignment Length:1899 Identity:501/1900 (26%)
Similarity:896/1900 (47%) Gaps:376/1900 (20%)


Human   316 LSRSWL----RSGEGPRRE--PSDLD-SEAASHAHSQ------AKTEEQI--------------- 352
            :..:||    :|...|:.|  .|::. .:||::..::      ||..|::               
  Fly     1 MKSAWLALKSKSALHPKSEYPVSNIHYPKAANYRQTRNYLEIAAKMSEEVDRNDPELKYLSVERN 65

Human   353 -----AAEEAWNETEKVWLVHRDGFSLASQLKSEELNLPEGKVRVKLDHDGAILDVDEDDVEKAN 412
                 |.:..|.:...||:.|.:...:|:.:|.|.    ..:|.|:|...|..:.:..||::|.|
  Fly    66 QFNDPATQAEWTQKRLVWVPHENQGFVAASIKREH----GDEVEVELAETGKRVMILRDDIQKMN 126

Human   413 APSCDRLEDLASLVYLNESSVLHTLRQRYGASLLHTYAGPSLLVLGPRGAPAVYSEKVMHMFKGC 477
            .|..|::||:|.|..|||:||||.::.||.:.|::||:|...:|:.|.....:|:||:|..:||.
  Fly   127 PPKFDKVEDMAELTCLNEASVLHNIKDRYYSGLIYTYSGLFCVVVNPYKKLPIYTEKIMERYKGI 191

Human   478 RREDMAPHIYAVAQTAYRAMLMSRQDQSIILLGSSGSGKTTSCQHLVQYLATIA----------- 531
            :|.::.||::|:..:|||.||..|:||||:..|.||:|||.:.:.::|:||.:|           
  Fly   192 KRHEVPPHVFAITDSAYRNMLGDREDQSILCTGESGAGKTENTKKVIQFLAYVAASKPKGSGAVP 256

Human   532 --------GISGNKVFSVE------------------------------KWQALYT--LLEAFGN 556
                    .::.||...|:                              :.|.|..  :||||||
  Fly   257 HPAVLINFSVNTNKYIKVKIMAQNQNQTIEVVNGLKMVEVNSNCQEGELEQQLLQANPILEAFGN 321

Human   557 SPTIINGNATRFSQILSLDFDQAGQVASASIQTMLLEKLRVARRPASEATFNVFYYLLACGDGTL 621
            :.|:.|.|::||.:.:.::||.:|.::.|:|:|.||||.|..|:...|.||::||.|||......
  Fly   322 AKTVKNDNSSRFGKFIRINFDASGFISGANIETYLLEKSRAIRQAKDERTFHIFYQLLAGATPEQ 386

Human   622 RTELHLNHLAENNVF---GIVPLAKPEEKQKAAQQFSKLQA---AMKVLGISPDEQKACWFILAA 680
            |.:..|:.: ::..|   |.:|:       .....:::.||   :|.::|::.::..:.:.|::|
  Fly   387 REKFILDDV-KSYAFLSNGSLPV-------PGVDDYAEFQATVKSMNIMGMTSEDFNSIFRIVSA 443

Human   681 IYHLGAAGATKEAPEEQAEAAEAGRKQFARHEWAQKAAYLLGCSLEELSSAIFKHQHKGGTLQRS 745
            :...|:....:|...:||...:        :..|||.|:|||.|:.:::.|....:.|.|  :..
  Fly   444 VLLFGSMKFRQERNNDQATLPD--------NTVAQKIAHLLGLSVTDMTRAFLTPRIKVG--RDF 498

Human   746 TSFRQGPEESGLGDGTGPKLSALECLEGMAAGLYSELFTLLVSLVNRALKSSQHSLCSMM-IVDT 809
            .:..|..|:...            .:|.:|...|..:|..||:.:||:|..::....|.: |:|.
  Fly   499 VTKAQTKEQVEF------------AVEAIAKACYERMFKWLVNRINRSLDRTKRQGASFIGILDM 551

Human   810 PGFQNPEQGGSARGASFEELCHNYTQDRLQRLFHERTFVQELERYKEENIELAFD----DLEPPT 870
            .||:..|..      |||:||.|||.::||:||:...|:.|.|.|:.|.||..|.    ||:|..
  Fly   552 AGFEIFELN------SFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWKFIDFGLDLQPTI 610

Human   871 DDSVAAVDQASHQSLVRSLARTDEARGLLWLLEEEALVPGASEDTLLERLFSYYGPQEGDKKGQS 935
            |             |:      |:..|::.||:||...|.|::.|.:::|.|             
  Fly   611 D-------------LI------DKPGGIMALLDEECWFPKATDKTFVDKLVS------------- 643

Human   936 PLLHSSKPH----------HFLLGHSHGTNWVEYNVTGWLNYTKQNPATQNAPRLLQDSQKKIIS 990
              .||..|.          .|.:.|..|.  |:|:...|| ....:|..:|...|||.||...:.
  Fly   644 --AHSMHPKFMKTDFRGVADFAIVHYAGR--VDYSAAKWL-MKNMDPLNENIVSLLQGSQDPFVV 703

Human   991 NLFLGRAGSATVLSGSIAGLEGGSQLALRRATSMRKTFTTGMAAVKK---KSLCIQMKLQVDALI 1052
            |::            ..|.:.|.:|.||        |.|...|..:|   :::....|.|:..|:
  Fly   704 NIW------------KDAEIVGMAQQAL--------TDTQFGARTRKGMFRTVSHLYKEQLAKLM 748

Human  1053 DTIKKSKLHFVHCFLPVAEGWAGEPRSASSRRVSSSSELDLPSGDHCEAGLLQLDVPLLRTQLRG 1117
            ||::.:..:||.|.:|..|..||                             ::|.||:..|||.
  Fly   749 DTLRNTNPNFVRCIIPNHEKRAG-----------------------------KIDAPLVLDQLRC 784

Human  1118 SRLLDAMRMYRQGYPDHMVFSEFRRRFDVLAPHLTKKHGRNYIVVDERRAVEELLECLDLEKSSC 1182
            :.:|:.:|:.|||:|:.:.|.|||:|:::|.|::..|.     .:|.::|.|::::.|:|:.:..
  Fly   785 NGVLEGIRICRQGFPNRIPFQEFRQRYELLTPNVIPKG-----FMDGKKACEKMIQALELDSNLY 844

Human  1183 CMGLSRVFFRAGTLARLEEQRDEQTSRNLTLFQAACRGYLARQHFKKRKIQDLAIRCVQKNIKKN 1247
            .:|.|::|||||.||.|||:||.:.|..:..|||.|||:|||::::||..|..|||.:|:|....
  Fly   845 RVGQSKIFFRAGVLAHLEEERDFKISDLIVNFQAFCRGFLARRNYQKRLQQLNAIRIIQRNCAAY 909

Human  1248 KGVKDWPWWKLFTTVRPLIEVQLSEEQIRNKDEEIQQLRSKLEKAEKERNELRLNSDRLESRISE 1312
            ..:::|.||:|:|.|:||:||...||::..|::|::|:|.||:...|       |:...|.:..:
  Fly   910 LKLRNWQWWRLYTKVKPLLEVTKQEEKLVQKEDELKQVREKLDTLAK-------NTQEYERKYQQ 967

Human  1313 LTSELTDERNTGESASQLLDAETAERLRAEKEM----KELQTQYDALKKQMEVMEMEVMEARLIR 1373
            ...|.|               ..||:|:||.|:    :|.:::..|.|:::|.| |:.:|.|:  
  Fly   968 ALVEKT---------------TLAEQLQAEIELCAEAEESRSRLMARKQELEDM-MQELETRI-- 1014

Human  1374 AAEINGEVDDDDA---GGEWRLKYERAVREVDFTKKRLQ---QEFEDKLEVEQ--QNKRQLERRL 1430
                  |.:::..   |||               ||:|:   |:.|::||.|:  :.|.|||:..
  Fly  1015 ------EEEEERVLALGGE---------------KKKLELNIQDLEEQLEEEEAARQKLQLEKVQ 1058

Human  1431 GDLQADSEESQRAL-----QQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDSELSQAH 1490
            .|.:....|...||     |:|.|:.:.|.....|....|..::.:...|.|.:.:.::.:|:..
  Fly  1059 LDAKIKKYEEDLALTDDQNQKLLKEKKLLEERANDLSQTLAEEEEKAKHLAKLKAKHEATISELE 1123

Human  1491 EEAQREKLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAELQDISSQESKDEAS 1555
            |...:::.||::..|.|..:..|...||:||.|:.:.:.....::...|.||.....:..::.|:
  Fly  1124 ERLHKDQQQRQESDRSKRKIETEVADLKEQLNERRVQVDEMQAQLAKREEELTQTLLRIDEESAT 1188

Human  1556 LAKVKKQLRDLEAKVKDQEEELDEQAGTIQMLEQAKLRLEMEMERMRQTHSKEMESRDEEV--EE 1618
            .|..:|..|:||:::.:.:|:|:.:.......|:.:..|..|:|.::   ::.::|.|...  :|
  Fly  1189 KATAQKAQRELESQLAEIQEDLEAEKAARAKAEKVRRDLSEELEALK---NELLDSLDTTAAQQE 1250

Human  1619 ARQSCQKKLKQMEVQLEEEYEDKQKVLREKRELEG-KLATLSDQVNRRDFESEKRLRKDLKRTKA 1682
            .|...:::|..::..||||..:.:.||.:.|.... :|.:::||:            ::|::.|.
  Fly  1251 LRSKREQELATLKKSLEEETVNHEGVLADMRHKHSQELNSINDQL------------ENLRKAKT 1303

Human  1683 LLADAQLMLDHLKNSAPSKREIAQLKNQLEESEFTCAAAVKARKAMEVEIEDLHLQIDDIAKAKT 1747
            :|..|:..|:  ..:|....|:..:.:..:|::       :.||..|.:|.:|.:::.:|.:|::
  Fly  1304 VLEKAKGTLE--AENADLATELRSVNSSRQEND-------RRRKQAESQIAELQVKLAEIERARS 1359

Human  1748 ALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKAAVAQASRDLAQINDLQAQLEEANKEKQEL 1812
            .|:|:.::||:|...|.|:|||.:       .|..|||..||...:|:.:.|..|||..::|..|
  Fly  1360 ELQEKCTKLQQEAENITNQLEEAE-------LKASAAVKSASNMESQLTEAQQLLEEETRQKLGL 1417

Human  1813 QEKLQALQSQVEFLEQSMVDKSLVSRQ-EAKIRELETRL-------EFERTQVKRLESLASRLKE 1869
            ..||:.::|:.|.|::.:.:.....|. |.|:.|:.|::       |.:....|.||....||.:
  Fly  1418 SSKLRQIESEKEALQEQLEEDDEAKRNYERKLAEVTTQMQEIKKKAEEDADLAKELEEGKKRLNK 1482

Human  1870 NMEKLTEERDQRIAAENREKEQNKRLQRQLRDTKEEMGELARKEAEASRKKHEL----------- 1923
            ::|.|..:..:.||..:|..:..|::|.:|.|...|:.....|..|..:|:...           
  Fly  1483 DIEALERQVKELIAQNDRLDKSKKKIQSELEDATIELEAQRTKVLELEKKQKNFDKILAEEKAIS 1547

Human  1924 -----EMDLESLEAANQ-----SLQADLKLAFKRIGDLQAAIEDEMESDENE--DLINSEGDSDV 1976
                 |.|....||..:     |:..:|..||.:|.||    |::.::.:||  ||.|::|.:|.
  Fly  1548 EQIAQERDTAEREAREKETKVLSVSRELDEAFDKIEDL----ENKRKTLQNELDDLANTQGTADK 1608

Human  1977 D-SELEDRVDGVKSWLSKNKGPSKAASDDGSLKSSSPTSYWKSLAPDRSDDEHDPLDN----TSR 2036
            : .|||.....::|.|::.|..::...||..|...:......::...||..|.|.|..    ..:
  Fly  1609 NVHELEKAKRALESQLAELKAQNEELEDDLQLTEDAKLRLEVNMQALRSQFERDLLAKEEGAEEK 1673

Human  2037 PRYSHSYLSDSDTE 2050
            .|.....|.|.:||
  Fly  1674 RRGLVKQLRDLETE 1687

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MYO18ANP_001333694.1 Interaction with actin 114..118
zipNP_523860.2 Myosin_N 80..117 CDD:280832 10/41 (24%)
Myosin_head 133..854 CDD:278492 232/848 (27%)
MYSc_Myh2_insects_mollusks 145..854 CDD:276876 225/836 (27%)
Myosin_tail_1 931..2011 CDD:279860 202/839 (24%)
Prefoldin 1431..1515 CDD:298833 21/84 (25%)
FAM76 <1847..1926 CDD:292665
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.