DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: anchor and PIN7

Sequence 1:NP_001261995.1 Gene:anchor FlyBaseID:FBgn0036741 Length:957 Species:Drosophila melanogaster
Sequence 2:NP_849700.1 Gene:PIN7 AraportID:AT1G23080 Length:619 Species:Arabidopsis thaliana

Alignment Length:142 Identity:37/143 (26%)
Similarity:66/143 (46%) Gaps:18/143 (13%)


  Fly    53 ALVQCFGIIICGYIAGR-FKIISNAETKGLGTFVGTFALPSLIFLSLVELNWSAVNWSFLLAMLV 116
            |::..:..:|..|.:.| :||.|..:..|:..||..||:|.|.|..:...|..|:|..|:.|..:
plant    13 AVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFISSNNPYAMNLRFIAADTL 77

  Fly   117 SKAVVFFAVLIISLLVARPLNYARGGLM----AIF--CTQSNDFAIGYPIVMALYKDVHPEYASY 175
            .|.::...::|.:       |:.|.|.:    .||  .|..|...:|.|:::|:|    .||:..
plant    78 QKLIMLTLLIIWA-------NFTRSGSLEWSITIFSLSTLPNTLVMGIPLLIAMY----GEYSGS 131

  Fly   176 LYLMAPISLAIL 187
            |.:...:...|:
plant   132 LMVQIVVLQCII 143

Known Domains:


GeneSequenceDomainRegion External IDIdentity
anchorNP_001261995.1 Mem_trans 53..387 CDD:304621 37/143 (26%)
DEP_GPR155 871..953 CDD:239890
PIN7NP_849700.1 Mem_trans 9..>190 CDD:281537 37/143 (26%)
Mem_trans <455..614 CDD:281537
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
10.910

Return to query results.
Submit another query.