DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: anchor and Deptor

Sequence 1:NP_001261995.1 Gene:anchor FlyBaseID:FBgn0036741 Length:957 Species:Drosophila melanogaster
Sequence 2:XP_001066889.3 Gene:Deptor RGDID:1561030 Length:409 Species:Rattus norvegicus

Alignment Length:305 Identity:66/306 (22%)
Similarity:104/306 (34%) Gaps:103/306 (34%)


  Fly   661 GSGGGGCGSGNGTCCSGGAPVSNSSTTSTVVVDIEDLLNRTRQRASGANNKDLNKIESAPATEEI 725
            ||.||..||.:....||||........:.|:|..|.|  |.|...........:.:::.|     
  Rat     4 GSSGGSGGSDSNAGGSGGAQQRELERMAEVLVTGEQL--RLRLHEEKVIKDRRHHLKTYP----- 61

  Fly   726 RNQMCSSSFNCGPSTSRQSCQTIIERYEDQNR------------RGLEPLEHPSDADEHQTLKHT 778
                     ||  ..:::....:||..|..:|            ||:  :.|.  .|||:..|..
  Rat    62 ---------NC--FVAKELIDWLIEHKEASDRETAIKLMQKLADRGI--IHHV--CDEHKEFKDV 111

  Fly   779 VLLITLLCSMFVGLAVSIWTLVMEGMSGIYLELSFLDAFLNFGQGLIVLAVFITDIGELLMPVVK 843
                    .:|........|..::         :.:.||:. ||                    :
  Rat   112 --------KLFYRFRKDDGTFPLD---------NEVKAFMR-GQ--------------------R 138

  Fly   844 LWRKLWYGANVVSLPHWSNVRPETKHICEQFRNHHLENCKKDIAKDRRWRIRVYRRVFYGTEFVS 908
            |:.||              :.|||..:  |.|..  |..|             |.|.|..:||:.
  Rat   139 LYEKL--------------MSPETTLL--QPREE--EGVK-------------YERTFMASEFLD 172

  Fly   909 WLIEVGLSKDRMEAVHYARHLVDGRVLRHINNVYHFEDKLLLYNF 953
            ||::.|.:..|.||......|::..:::|::|.:.|.|..|||.|
  Rat   173 WLVQEGEATTRKEAEQLCHRLMEHSIIQHVSNKHPFVDSNLLYQF 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
anchorNP_001261995.1 Mem_trans 53..387 CDD:304621
DEP_GPR155 871..953 CDD:239890 23/82 (28%)
DeptorXP_001066889.3 DEP_1_DEP6 36..117 CDD:239889 19/111 (17%)
DEP_2_DEP6 133..217 CDD:239888 32/136 (24%)
PDZ_signaling 339..403 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.