DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: anchor and gpr155a

Sequence 1:NP_001261995.1 Gene:anchor FlyBaseID:FBgn0036741 Length:957 Species:Drosophila melanogaster
Sequence 2:XP_005172576.1 Gene:gpr155a ZFINID:ZDB-GENE-100922-89 Length:814 Species:Danio rerio

Alignment Length:944 Identity:290/945 (31%)
Similarity:461/945 (49%) Gaps:148/945 (16%)


  Fly    27 MASSLANGTATPRADDG------GVSMNNFYPALVQCFGIIICGYIAGRFKIISNAETKGLGTFV 85
            |...|.|.:.:.|.:.|      .:|::...|||::|||||:|||:|||..||...:.||||:||
Zfish     1 MEDLLGNVSVSSRDESGAPTVPPSMSIDKLLPALLECFGIILCGYVAGRTNIILATQAKGLGSFV 65

  Fly    86 GTFALPSLIFLSLVELNWSAVNWSFLLAMLVSKAVVFFAVLIISLLVA-RPLNYARGGLMAIFCT 149
            ..||||:|:|.::|.|::..|.|.|..::||:|..|||.|.:::|||. |...|::.||..||.|
Zfish    66 SKFALPALLFKNMVLLDFGDVIWPFFFSILVAKVTVFFFVCVLTLLVGNRESRYSKAGLFPIFAT 130

  Fly   150 QSNDFAIGYPIVMALYKDVHPEYASYLYLMAPISLAILNPVGLVLMEISKIIKNKEDVTRNPPLC 214
            ||||||:|:|||.|||:..||||..|:||:||:||.:|||:|.:..|:.: .||.|         
Zfish   131 QSNDFALGFPIVEALYRSTHPEYLQYIYLVAPVSLMVLNPLGFMFCEVQR-RKNGE--------- 185

  Fly   215 PETCPAEQMSKRNRCLGERSILVFNTLIALFFNPLLLMTLLGVAGGFLFPNGLPEMVSSTLRVLG 279
                |::|  .:...||    ||   ::.:|.||::.|.::|:...||....:|..:...:..|.
Zfish   186 ----PSQQ--SKLHVLG----LV---VLQVFKNPIVFMVMIGLVSHFLLCQKIPAFMEQFVDGLA 237

  Fly   280 QSFSATALFLLGLKIVGGTGS-ERKSIGFLLPGVLILVKILVLPLVIRQTVNIM-QSGQNFNDTT 342
            .||...|||.|||.:||.... .|.::..|:  :||..|:|::||:.|..|.:: .:.::..:.|
Zfish   238 NSFGGAALFYLGLSMVGQLKKLTRTTVVALI--LLITAKLLMMPLICRGMVEVLDNTNRSTLNHT 300

  Fly   343 ELSTFGFLYGTFPAAPGAFVIATQYNMEVELVARSMVFCTFISAPLMFISAKMISLTNLKPLDYL 407
            .||.:.||||.||.||...:.|..||||:|:|...||..||:|||:|::||.::::..:......
Zfish   301 SLSNYAFLYGVFPTAPSVAIYAAHYNMELEVVTSGMVVSTFLSAPIMYVSAWLLTIPWMDSAPLA 365

  Fly   408 HELDAFSFDISVAGAAACCIMLALLIVTKRFKRMPQRITFCLVLSQLMCCIGVILWSKMEHVHRW 472
            ..|...|||||:....|....|.::|:::::.|:|...|..|.::||:.|:|:|:|:.:  |.:.
Zfish   366 SALQNVSFDISIISLFALVWSLTVMILSRKYHRIPHIFTINLFVAQLLVCVGMIVWNFV--VKQD 428

  Fly   473 PLYLQFLLFNI---GTYSTRLWTGLLAISLLFLQCRSLCFVLKLWPYMLVFAWGVPAVLSALLIA 534
            ....|.|.|.:   ..|||.:|.||:.:|||.::...:.|...|   .::..||:|.:..::|: 
Zfish   429 SFVAQVLSFTLLYGSLYSTYIWPGLIVLSLLLMRSEEVNFRPGL---TVITGWGLPFLAVSVLL- 489

  Fly   535 FDSNVMSGEKH----NPSFQYGNAQAAISVFMLVMCFIVTVGCLVLHQRYKKRYEKYMTYSRELS 595
                 :||.:.    :.:|.||..|  :....:|:|..:.| |.|......:|.:.|.       
Zfish   490 -----LSGHRMPDTIDSAFFYGTTQ--VMCTSVVLCVSIAV-CGVSLALLSRRTQDYQ------- 539

  Fly   596 NPESESSDLHSTISTTNLLSHTDQSSIRQSVRTASYSSSSDDEEMIPTAAGLPTSRSNGAASGGA 660
                            ||:|.:              .|.|:::..||..|.:.            
Zfish   540 ----------------NLVSGS--------------LSGSEEDLRIPYNAPVQ------------ 562

  Fly   661 GSGGGGCGSGNGTCCSGGAPVSNSSTTSTVVVDIEDLLNRTRQRASGANNKDLNKIESAPATEEI 725
                   ||...||..|      |:.|:..:.:....|.:||                 |.....
Zfish   563 -------GSIEDTCTLG------STNTACQMCECACALPQTR-----------------PDVTNT 597

  Fly   726 RNQMCSSSFNCGPSTSRQSCQTIIERYEDQNRRGLEPLEHPSDADEHQTLKHTVLLITLLCSMFV 790
            :.::...:..||...:...|..:.|..::..|:.          .:.|:.:|.::.:.|..:...
Zfish   598 KEEVSIQTGQCGQECTSTHCLLVEEEEKETERQN----------TDIQSTRHVLMCLILTVTSLA 652

  Fly   791 GLAVSIWTLVMEGMSGIYLELSFLDAFLNFGQGLIVLAVFITDIGELLMPVVKLWRKLW-YGANV 854
            .|...:|.|..:....:||||.|.....|:|||||..|.|..|...::.|..|....:| :.|.:
Zfish   653 NLCSCLWWLFNKDPGRLYLELQFFCVVANYGQGLISFAFFGLDKHLIISPFKKRLESVWQWWAQL 717

  Fly   855 VSLPHWSNVRPETKHICEQFRNHHLENCKKDIAKDRRWRIRVYRRVFYGTEFVSWLIEVGLSKDR 919
            ||   .|.|..|.:..|.||..:|.:.|.|||...:|...:...:.|.||:.|.||..|||:.|:
Zfish   718 VS---GSEVSEEIRLTCNQFLKYHKKQCIKDIVHKKRCGEKSSIQAFLGTDMVVWLQSVGLASDQ 779

  Fly   920 MEAVHYARHLVDGRVLRHINNVYHFEDKLLLYNF 953
            .|||.|...|:||.|::||...:.|||:.|.|.|
Zfish   780 GEAVLYGSRLLDGGVIQHITQQHAFEDQTLHYRF 813

Known Domains:


GeneSequenceDomainRegion External IDIdentity
anchorNP_001261995.1 Mem_trans 53..387 CDD:304621 140/337 (42%)
DEP_GPR155 871..953 CDD:239890 34/82 (41%)
gpr155aXP_005172576.1 YfdV 33..357 CDD:223751 144/349 (41%)
DEP_GPR155 731..813 CDD:239890 34/82 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C343417657
eggNOG 1 0.900 E1_2BZ3U
Hieranoid 1 1.000
Homologene 1 1.000 H16584
Inparanoid 1 1.050 414 1.000 Inparanoid score I1771
OMA 1 1.010
OrthoDB 1 1.010 D123487at33208
OrthoFinder 1 1.000 FOG0005837
OrthoInspector 1 1.000 T596168
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR22829
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5681
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.990

Return to query results.
Submit another query.