DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: anchor and gpr155b

Sequence 1:NP_001261995.1 Gene:anchor FlyBaseID:FBgn0036741 Length:957 Species:Drosophila melanogaster
Sequence 2:XP_017212067.1 Gene:gpr155b ZFINID:ZDB-GENE-110815-2 Length:749 Species:Danio rerio

Alignment Length:870 Identity:262/871 (30%)
Similarity:413/871 (47%) Gaps:183/871 (21%)


  Fly    45 VSMNNFYPALVQCFGIIICGYIAGRFKIISNAETKGLGTFVGTFALPSLIFLSLVELNWSAVNWS 109
            :|::..:|||::|||||:|||.|||..|||.|:..|||:||..||||:|:|.::|:|.:..|.||
Zfish    23 MSIDKLFPALLECFGIILCGYAAGRSGIISAAQVNGLGSFVSCFALPALLFKNMVQLQFQHVVWS 87

  Fly   110 FLLAMLVSKAVVFFAVLIISLLVARP-LNYARGGLMAIFCTQSNDFAIGYPIVMALYKDVHPEYA 173
            ||.::|::|..||..|.:::||||.| ..|::.||.|||.|||||||:|||||.|||::.|.||.
Zfish    88 FLWSVLIAKVCVFTLVCVLTLLVADPESKYSKAGLFAIFATQSNDFALGYPIVDALYRNSHSEYE 152

  Fly   174 SYLYLMAPISLAILNPVGLVLMEISKIIKNKEDVTRNPPLCPETCPAEQMSKRNRCLGERSILVF 238
            .|:||:||:||.:|||||..|.||.: .::..|              ...||.:        ::|
Zfish   153 QYIYLVAPVSLMLLNPVGFALCEIQR-WRHSSD--------------PNYSKLH--------VIF 194

  Fly   239 NTLIALFFNPLLLMTLLGVAGGFLFPNGLPEMVSSTLRVLGQSFSATALFLLGLKIVGGTGSERK 303
            ...:.:..||::.|.::|:...|:|...:|.::...:..|..||...|||.|||.:||......:
Zfish   195 TVTLQVLKNPIVFMVMVGIVSHFVFGGRVPVLLGEFVDGLADSFGGAALFYLGLNMVGQMSKLTR 259

  Fly   304 SIGFLLPGVLILVKILVLPLVIRQTVNIMQSGQNFN-DTTELSTFGFLYGTFPAAPGAFVIATQY 367
            |.|..|. :||..|:||:||:.|..|.::.:|.:.: :.:.||.:.||||.||.||...:.|.||
Zfish   260 STGVSLI-LLITAKLLVMPLMCRDMVELLDAGNSSSANHSSLSDYAFLYGVFPTAPSVAIYAAQY 323

  Fly   368 NMEVELVARSMVFCTFISAPLMFISAKMISLTNLKPLDYLHELDAFSFDISVAGAAACCIMLALL 432
            |||:|:|...||..||:|||:|::||.::::..::....:.||...||:||:....|....||::
Zfish   324 NMELEVVTSGMVISTFLSAPIMYVSAWLLTIPWMEASFLVKELQDVSFNISIVCLIALVWTLAVM 388

  Fly   433 IVTKRFKRMPQRITFCLVLSQLMCCIGVILWSKMEHVHRWPLYLQFLLFNI---GTYSTRLWTGL 494
            :::|:|:|||......|.|:||:.|:.::.|..:  :.:..::.|.|.|.:   ..|||.:||||
Zfish   389 LLSKKFRRMPHMFATNLFLAQLLACMSMLFWKFV--LKQGSVFGQILTFTLLYGSLYSTYVWTGL 451

  Fly   495 LAISLLFLQCRSLCFVLKLWPYM-LVFAWGVPAVLSALLIAFDSNVMSGEKHNPSFQYGNAQAAI 558
            ||.||..|....   .||:.|.: ::|.||:|.:....|:.....:  .:..:|:|.||:.|...
Zfish   452 LAFSLTLLGRNE---NLKVKPIVFIIFGWGIPFLTVGGLLMIGQRM--SDSLDPAFFYGSGQIVS 511

  Fly   559 SVFMLVMCFIVTVGCLVL---------HQRYKKRYEKYMT----YSRELSNPESESSDLHSTIST 610
            :|  :|:.|.:.:|.|.|         .|.|:...:..:|    .||.|......|||:..|.:.
Zfish   512 TV--VVLGFSIVLGGLSLMGLSRGAQEEQSYQALDQNSITGASENSRHLQTENQNSSDVDQTHTN 574

  Fly   611 TNLLSHTDQSSIRQSVRTASYSSSSDDEEMIPTAAGLPTSRSNGAASGGAGSGGGGCGSGNGTCC 675
            |::                                                            ||
Zfish   575 TDV------------------------------------------------------------CC 579

  Fly   676 SGGAPVSNSSTTSTVVVDIEDLLNRTRQRASGANNKDLNKIESAPATEEIRNQMCSSSFNCGPST 740
            |...|               |::              ...:..:|..        |:....|.|:
Zfish   580 SEPMP---------------DMI--------------AGHLNDSPVP--------SAGIVLGESS 607

  Fly   741 SRQSCQTIIERYEDQNRRGLEPLEHPSDADEHQTLKHTVLLITLLCSMFVGLAVSIWTLVMEGMS 805
            |....|                       :|.|..:|.:|.:.|:.||...|:..:|.|......
Zfish   608 SSLRVQ-----------------------EERQIARHVLLCLLLIVSMLANLSSCLWWLFSADPG 649

  Fly   806 GIYLELSFLDAFLNFGQGLIVLAVFITDIGELLMPVVKLWRKLWYGANVVSLPHWSNVRP----- 865
            .:||||.|..|..|:|||.:...:|..|...:::|    :||..  |.:.......|:.|     
Zfish   650 RLYLELQFFCAVANYGQGFVSFGIFGLDEHLIILP----FRKRL--AALCGFSQEENLEPSAVPE 708

  Fly   866 ETKHICEQFRNHHLENCKKDIAKDR 890
            |.:..|.||..:|.:.|.:||.::|
Zfish   709 EIRLTCTQFVRYHKDQCVQDIVRNR 733

Known Domains:


GeneSequenceDomainRegion External IDIdentity
anchorNP_001261995.1 Mem_trans 53..387 CDD:304621 143/336 (43%)
DEP_GPR155 871..953 CDD:239890 8/21 (38%)
gpr155bXP_017212067.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C343417068
eggNOG 1 0.900 E1_2BZ3U
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 414 1.000 Inparanoid score I1771
OMA 1 1.010
OrthoDB 1 1.010 D123487at33208
OrthoFinder 1 1.000 FOG0005837
OrthoInspector 1 1.000 T596168
orthoMCL 1 0.900 OOG5_132383
Panther 1 1.100 O PTHR22829
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5681
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.