DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps60 and VPS60

Sequence 1:NP_001261994.1 Gene:Vps60 FlyBaseID:FBgn0036740 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_010774.4 Gene:VPS60 SGDID:S000002894 Length:229 Species:Saccharomyces cerevisiae

Alignment Length:220 Identity:73/221 (33%)
Similarity:116/221 (52%) Gaps:21/221 (10%)


  Fly     1 MNRLFGRGKPK-------EPGPSLNDCIAGVDARATNIEEKISNLEAELRKYREQMSKMREGPAK 58
            |||:||.|..|       |...|:|.....:..|.:.::.:|:.|..:|:..::.:  .|....:
Yeast     1 MNRIFGYGNKKSHDQLLQESNQSMNQAQQSLSNRISQLDTQIAQLNFQLQNIQKNL--QRSNNKQ 63

  Fly    59 NSVKQKALRVLKQKKAYEQQAESLRNQSFNMEQANYAAQSLKDTQATVAAMKDGVKQMKTEYKKI 123
            .|::::||::|.::|..|...:||.:||::|.||.....:|::|..|:.|:|.....||.:|.||
Yeast    64 PSLRKQALKILNKRKQLENMKDSLDSQSWSMTQAQLTNDNLQNTMITINALKQTNNAMKAQYGKI 128

  Fly   124 NIDQIEDIQDDMADMFEQADEVQEALGRTYGMPEVD---DDDLQAELDALGDE-IAL-------- 176
            |||:::|:||:|.|:.||.||:||.|.......|:|   |.:|.||||||..| ..|        
Yeast   129 NIDKLQDMQDEMLDLIEQGDELQEVLAMNNNSGELDDISDAELDAELDALAQEDFTLPTSENSLG 193

  Fly   177 DDDTSYLDDVVKAPEAPSREPGADS 201
            :|..|||......|.....||..|:
Yeast   194 NDMPSYLLGANAPPAFIDEEPNLDT 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps60NP_001261994.1 Snf7 1..190 CDD:304451 69/208 (33%)
VPS60NP_010774.4 Snf7 19..181 CDD:308778 56/164 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C273827553
eggNOG 1 0.900 E1_KOG1655
Hieranoid 1 1.000
Homologene 1 1.000 H5757
Inparanoid 1 1.050 112 1.000 Inparanoid score I1341
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003082
OrthoInspector 1 1.000 T1136722
orthoMCL 1 0.900 OOG5_128328
Panther 1 1.100 LDO PTHR22761
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2003
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.