DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps60 and SNF7

Sequence 1:NP_001261994.1 Gene:Vps60 FlyBaseID:FBgn0036740 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_013125.1 Gene:SNF7 SGDID:S000004015 Length:240 Species:Saccharomyces cerevisiae

Alignment Length:237 Identity:67/238 (28%)
Similarity:114/238 (48%) Gaps:54/238 (23%)


  Fly     4 LFG----RGKPKEPGPS-----LNDCIAGVDARATNIEEKISNLEAELRKYREQMSKMREGPAKN 59
            |||    ..|.|| .|:     |.:.|..:..:.:::..:|:|.|.|.|.:   ::|..:..|||
Yeast     5 LFGWTSSNAKNKE-SPTKAIVRLREHINLLSKKQSHLRTQITNQENEARIF---LTKGNKVMAKN 65

  Fly    60 SVKQKALRVLKQKKAYEQ-------QAESLRNQSFNMEQANYAAQSLKDTQATVAAMKDGVKQMK 117
            :        ||:||..||       ..||:..|.|::|.||...:       |:.||::|.|.||
Yeast    66 A--------LKKKKTIEQLLSKVEGTMESMEQQLFSIESANLNLE-------TMRAMQEGAKAMK 115

  Fly   118 TEYKKINIDQIEDIQDDMADMFEQADEVQEALGRTY--GMPEVDDDDLQAELDALGDEIALDDDT 180
            |.:..::||::::..|::.:..|..||:.:|:.|..  |..|||:|:|..|||.|..|.|..:.:
Yeast   116 TIHSGLDIDKVDETMDEIREQVELGDEISDAISRPLITGANEVDEDELDEELDMLAQENANQETS 180

  Fly   181 SYLDDVVKAPEAPSREPGADSIVPGKSTIETDEFGLPKIPTS 222
            ..:::.|.|  ||               |..::..||.:|::
Yeast   181 KIVNNNVNA--AP---------------ISENKVSLPSVPSN 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps60NP_001261994.1 Snf7 1..190 CDD:304451 61/204 (30%)
SNF7NP_013125.1 Snf7 21..206 CDD:308778 60/221 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.