DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps60 and VPS60.2

Sequence 1:NP_001261994.1 Gene:Vps60 FlyBaseID:FBgn0036740 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001190228.1 Gene:VPS60.2 AraportID:AT5G04850 Length:272 Species:Arabidopsis thaliana

Alignment Length:270 Identity:100/271 (37%)
Similarity:149/271 (55%) Gaps:54/271 (20%)


  Fly     1 MNRLFGRGKPKEPGPSLNDCIAGVDARATNIEEKISNLEAELRKYREQMSKMREGPAKNSVKQKA 65
            |.|:||....|||.||:.|....::.|..::|||:..|:|||.||::|:.:.|.|||..::|.:|
plant     1 MKRIFGAKNNKEPPPSIQDASDRINKRGDSVEEKVKRLDAELCKYKDQIKRTRPGPALEAIKARA 65

  Fly    66 LRVLKQKKAYEQQAESLRNQSFNMEQANYAAQSLKDTQATVAAMKDGVKQMKTEYKKINIDQIED 130
            :|||||||.||.|.:.|.||:||::|.::||:.|||.|.|:.|:|...|::|...|.:.|..|::
plant    66 MRVLKQKKMYEGQRDMLYNQTFNLDQVSFAAEGLKDAQQTMTALKSANKELKGMMKTVKIQDIDN 130

  Fly   131 IQDDMADMFEQADEVQEALGRTYGMP-EVDDDDL------------------------------- 163
            :||||.|:.:::.|:||.|||:|.:| ::|:|||                               
plant   131 LQDDMMDLMDESSEIQETLGRSYNVPDDIDEDDLLGGKFFLCSLCCLSLGLVETISLCLLNSAPY 195

  Fly   164 ------QAELDAL----GDEIALDDDTSY--------LDDVVKAPEAPSREPGADSIVPGKSTIE 210
                  .:|||||    |:|...|...||        |:|.:..|.||....||.   ||::..|
plant   196 TLYRFVNSELDALEADMGNETEADGVPSYLQPDKEPDLNDELNLPSAPMGHTGAP---PGRAQAE 257

  Fly   211 TDEFGLPKIP 220
             ||:|||.:|
plant   258 -DEWGLPAVP 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps60NP_001261994.1 Snf7 1..190 CDD:304451 86/239 (36%)
VPS60.2NP_001190228.1 Snf7 1..219 CDD:304451 81/218 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H5757
Inparanoid 1 1.050 186 1.000 Inparanoid score I1370
OMA 1 1.010
OrthoDB 1 1.010 D1301560at2759
OrthoInspector 1 1.000 T124565
orthoMCL 1 0.900 OOG5_128328
Panther 1 1.100 LDO PTHR22761
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.