DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps60 and VPS60.1

Sequence 1:NP_001261994.1 Gene:Vps60 FlyBaseID:FBgn0036740 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_187675.2 Gene:VPS60.1 AraportID:AT3G10640 Length:235 Species:Arabidopsis thaliana

Alignment Length:233 Identity:101/234 (43%)
Similarity:147/234 (63%) Gaps:17/234 (7%)


  Fly     1 MNRLFGRGKPKEPGPSLNDCIAGVDARATNIEEKISNLEAELRKYREQMSKMREGPAKNSVKQKA 65
            |.|:||..|..||.||:.|....::.|..::|:||..|:.||.||:||:.|.|.|||:.:||.:|
plant     1 MRRVFGAKKNTEPPPSIQDASDRINKRGDSVEDKIKKLDVELCKYKEQLKKTRPGPAQEAVKARA 65

  Fly    66 LRVLKQKKAYEQQAESLRNQSFNMEQANYAAQSLKDTQATVAAMKDGVKQMKTEYKKINIDQIED 130
            :|||||||.||.|.:.|.||:||::|.::||:.|||.|.|:.|:|...|::|...|.:.|..|::
plant    66 MRVLKQKKMYEGQRDMLYNQTFNLDQVSFAAEGLKDAQQTMTALKSANKELKGMMKTVKIQDIDN 130

  Fly   131 IQDDMADMFEQADEVQEALGRTYGMPE-VDDDDLQAELDAL----GDEIALDDDTSYL------- 183
            :||:|.|:.:.:.|:||:|||:|.:|: :|:|||..|||||    |:|...|...|||       
plant   131 LQDEMMDLMDVSSEIQESLGRSYNIPDGLDEDDLMGELDALEADMGNETEADGMPSYLQPDTETD 195

  Fly   184 -DDVVKAPEAPSREPGADSIVPGKSTIETDEFGLPKIP 220
             |..:..|.||:...||..   |::..| ||||||.:|
plant   196 YDSELNLPAAPTGHNGAPH---GRAQAE-DEFGLPAVP 229

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps60NP_001261994.1 Snf7 1..190 CDD:304451 87/202 (43%)
VPS60.1NP_187675.2 Snf7 1..195 CDD:328813 86/194 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H5757
Inparanoid 1 1.050 186 1.000 Inparanoid score I1370
OMA 1 1.010
OrthoDB 1 1.010 D1301560at2759
OrthoInspector 1 1.000 T124565
orthoMCL 1 0.900 OOG5_128328
Panther 1 1.100 O PTHR22761
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.