DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps60 and chmp5a

Sequence 1:NP_001261994.1 Gene:Vps60 FlyBaseID:FBgn0036740 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_686934.2 Gene:chmp5a ZFINID:ZDB-GENE-060503-60 Length:251 Species:Danio rerio

Alignment Length:222 Identity:128/223 (57%)
Similarity:167/223 (75%) Gaps:3/223 (1%)


  Fly     1 MNRLFGRGKPKEPGPSLNDCIAGVDARATNIEEKISNLEAELRKYREQMSKMREGPAKNSVKQKA 65
            |||:|||.| :...|:|:|||..||.|..:|::||:.::|||.||::||.|||:||:||:|||||
Zfish    33 MNRIFGRSK-QAASPNLSDCIGNVDTRIESIDKKIARIDAELMKYKDQMKKMRDGPSKNTVKQKA 96

  Fly    66 LRVLKQKKAYEQQAESLRNQSFNMEQANYAAQSLKDTQATVAAMKDGVKQMKTEYKKINIDQIED 130
            :||||||:.||.|.:.|..||||||||||..|||:||:.||.|||.|.|:||..||::.:|||||
Zfish    97 MRVLKQKRMYEGQRDQLSQQSFNMEQANYTIQSLRDTKTTVEAMKIGAKEMKKAYKQVKMDQIED 161

  Fly   131 IQDDMADMFEQADEVQEALGRTYGMPEVDDDDLQAELDALGDEIALDDDTSYLDDVVKAPEAPSR 195
            :||.:.||.|:|:||||||.|:||.||:|:|:|:|||||||||:.||||:||||:...||..|..
Zfish   162 LQDQLEDMMEEANEVQEALSRSYGTPEIDEDELEAELDALGDELLLDDDSSYLDEASSAPSIPEG 226

  Fly   196 EPGADSIVPGKSTIETDEFGLPKIPTS 222
            .|  ......|..:..||||||:||.:
Zfish   227 MP--SDTKTNKDGVLVDEFGLPQIPAT 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps60NP_001261994.1 Snf7 1..190 CDD:304451 116/189 (61%)
chmp5aXP_686934.2 Snf7 33..238 CDD:328813 120/208 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C273815835
eggNOG 1 0.900 E1_KOG1655
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1301560at2759
OrthoFinder 1 1.000 FOG0003082
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128328
Panther 1 1.100 O PTHR22761
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2003
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.750

Return to query results.
Submit another query.