DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps60 and chmp5

Sequence 1:NP_001261994.1 Gene:Vps60 FlyBaseID:FBgn0036740 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001016748.1 Gene:chmp5 XenbaseID:XB-GENE-5962693 Length:219 Species:Xenopus tropicalis

Alignment Length:222 Identity:140/223 (63%)
Similarity:172/223 (77%) Gaps:3/223 (1%)


  Fly     1 MNRLFGRGKPKEPGPSLNDCIAGVDARATNIEEKISNLEAELRKYREQMSKMREGPAKNSVKQKA 65
            ||||||:.|||.|..:|.|||:.||:|:.:|::|||.|:|||.||::||.||||||:||.|||||
 Frog     1 MNRLFGKSKPKVPPSTLTDCISNVDSRSESIDKKISRLDAELVKYKDQMKKMREGPSKNMVKQKA 65

  Fly    66 LRVLKQKKAYEQQAESLRNQSFNMEQANYAAQSLKDTQATVAAMKDGVKQMKTEYKKINIDQIED 130
            |||||||:.||||.::|..|||||||.|||.||||||:.||.|||.|.|:||..||::.||||||
 Frog    66 LRVLKQKRMYEQQRDNLNQQSFNMEQTNYAIQSLKDTKTTVDAMKVGAKEMKKAYKQVKIDQIED 130

  Fly   131 IQDDMADMFEQADEVQEALGRTYGMPEVDDDDLQAELDALGDEIALDDDTSYLDDVVKAPEAPSR 195
            :||.:.||.|.|:|:||||.|:||.||:|:|||:|||||||||:.|||||||||:...||..|..
 Frog   131 LQDQLEDMMENANEIQEALSRSYGTPEIDEDDLEAELDALGDELLLDDDTSYLDEAASAPAIPEG 195

  Fly   196 EPGADSIVPGKSTIETDEFGLPKIPTS 222
            .|. ||  ..|..:..||||||:||.:
 Frog   196 VPN-DS--KNKDGVLVDEFGLPQIPAT 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps60NP_001261994.1 Snf7 1..190 CDD:304451 126/189 (67%)
chmp5NP_001016748.1 Snf7 1..201 CDD:328813 131/203 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C273814661
eggNOG 1 0.900 E1_KOG1655
Hieranoid 1 1.000
Homologene 1 1.000 H5757
Inparanoid 1 1.050 282 1.000 Inparanoid score I2692
OMA 1 1.010
OrthoDB 1 1.010 D1301560at2759
OrthoFinder 1 1.000 FOG0003082
OrthoInspector 1 1.000 T601975
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2003
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.