DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps60 and CHMP5

Sequence 1:NP_001261994.1 Gene:Vps60 FlyBaseID:FBgn0036740 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_057494.3 Gene:CHMP5 HGNCID:26942 Length:219 Species:Homo sapiens

Alignment Length:222 Identity:140/223 (63%)
Similarity:171/223 (77%) Gaps:3/223 (1%)


  Fly     1 MNRLFGRGKPKEPGPSLNDCIAGVDARATNIEEKISNLEAELRKYREQMSKMREGPAKNSVKQKA 65
            ||||||:.|||.|.|||.|||..||:||.:|::|||.|:|||.||::|:.|||||||||.|||||
Human     1 MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKA 65

  Fly    66 LRVLKQKKAYEQQAESLRNQSFNMEQANYAAQSLKDTQATVAAMKDGVKQMKTEYKKINIDQIED 130
            |||||||:.||||.::|..||||||||||..||||||:.||.|||.|||:||..||::.||||||
Human    66 LRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIED 130

  Fly   131 IQDDMADMFEQADEVQEALGRTYGMPEVDDDDLQAELDALGDEIALDDDTSYLDDVVKAPEAPSR 195
            :||.:.||.|.|:|:||||.|:||.||:|:|||:|||||||||:..|:|:||||:...||..|. 
Human   131 LQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPE- 194

  Fly   196 EPGADSIVPGKSTIETDEFGLPKIPTS 222
              |..:....|..:..||||||:||.|
Human   195 --GVPTDTKNKDGVLVDEFGLPQIPAS 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps60NP_001261994.1 Snf7 1..190 CDD:304451 127/189 (67%)
CHMP5NP_057494.3 Snf7 1..201 CDD:328813 130/203 (64%)
Interaction with VTA1 121..158 23/37 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C273815426
eggNOG 1 0.900 E1_KOG1655
Hieranoid 1 1.000
Homologene 1 1.000 H5757
Inparanoid 1 1.050 282 1.000 Inparanoid score I2835
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1301560at2759
OrthoFinder 1 1.000 FOG0003082
OrthoInspector 1 1.000 T1074965
orthoMCL 1 0.900 OOG5_128328
Panther 1 1.100 LDO PTHR22761
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2003
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.