DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps60 and chmp5b

Sequence 1:NP_001261994.1 Gene:Vps60 FlyBaseID:FBgn0036740 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_956674.1 Gene:chmp5b ZFINID:ZDB-GENE-040426-1374 Length:220 Species:Danio rerio

Alignment Length:222 Identity:136/223 (61%)
Similarity:170/223 (76%) Gaps:2/223 (1%)


  Fly     1 MNRLFGRGKPKEPGPSLNDCIAGVDARATNIEEKISNLEAELRKYREQMSKMREGPAKNSVKQKA 65
            |||:|||||||.|.|:|.|||:|||:||.::::||:.|:|||.||::||.|||:||:||.|||||
Zfish     1 MNRIFGRGKPKGPPPNLTDCISGVDSRAESVDKKIARLDAELMKYKDQMKKMRDGPSKNMVKQKA 65

  Fly    66 LRVLKQKKAYEQQAESLRNQSFNMEQANYAAQSLKDTQATVAAMKDGVKQMKTEYKKINIDQIED 130
            :||||||:.||.|.:.|..||||||||||..|:||||:.||.|||.|.|:||..||.:.||||||
Zfish    66 MRVLKQKRMYEGQRDQLMQQSFNMEQANYTIQTLKDTKTTVEAMKIGAKEMKKAYKNVKIDQIED 130

  Fly   131 IQDDMADMFEQADEVQEALGRTYGMPEVDDDDLQAELDALGDEIALDDDTSYLDDVVKAPEAPSR 195
            :||.:.||.|.|:||||||.|:||.||:|:|||:|||||||||:.||||.||||:...||..|..
Zfish   131 LQDQLEDMMEDANEVQEALSRSYGTPEIDEDDLEAELDALGDELLLDDDNSYLDEASSAPAIPEG 195

  Fly   196 EPGADSIVPGKSTIETDEFGLPKIPTS 222
            .||  .....:..:..||||||:||.:
Zfish   196 APG--DRTTNRDGVLVDEFGLPQIPAT 220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps60NP_001261994.1 Snf7 1..190 CDD:304451 124/189 (66%)
chmp5bNP_956674.1 Snf7 1..190 CDD:304451 124/189 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C273815133
eggNOG 1 0.900 E1_KOG1655
Hieranoid 1 1.000
Homologene 1 1.000 H5757
Inparanoid 1 1.050 283 1.000 Inparanoid score I2797
OMA 1 1.010
OrthoDB 1 1.010 D1301560at2759
OrthoFinder 1 1.000 FOG0003082
OrthoInspector 1 1.000 T597812
orthoMCL 1 0.900 OOG5_128328
Panther 1 1.100 LDO PTHR22761
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2003
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.