DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps60 and shrb

Sequence 1:NP_001261994.1 Gene:Vps60 FlyBaseID:FBgn0036740 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_610462.3 Gene:shrb FlyBaseID:FBgn0086656 Length:226 Species:Drosophila melanogaster

Alignment Length:223 Identity:61/224 (27%)
Similarity:112/224 (50%) Gaps:26/224 (12%)


  Fly     3 RLFGRGKPKEPGPSLNDCIAGVDARATNIEEKISNLEAELRKYREQMSKMREGPAKNSVKQKALR 67
            ::|| || ||..|:..:.|..:......:.:|...|||   |..::::..|:..:||  |:.||:
  Fly     6 KMFG-GK-KEVAPTTGEAIQKLRETENMLIKKQEFLEA---KIEDELNIARKNASKN--KRVALQ 63

  Fly    68 VLKQKKAYEQQAESLRNQSFNMEQANYAAQSLKDTQATVAAMKDGVKQMKTEYKKINIDQIEDIQ 132
            .||:||..|:|.:.:......:|....|.:|.....|.:..||:....:|..::.:::|::.|:.
  Fly    64 ALKKKKRLEKQLQQIDGTLSTIEMQREALESANTNTAVLTTMKNAADALKRAHQNMDVDKVHDMM 128

  Fly   133 DDMADMFEQADEVQEALGR--TYGMPEVDDDDLQAELDALGDE------IALDDDTSYLDDVVKA 189
            ||:|:..:.|.|:.:|:..  .:| .::||:||:.|||.|..|      |.:.:.|..|      
  Fly   129 DDIAEQQDVAREISDAISNPVAFG-ADLDDEDLERELDELEQENFDKEIIGIPEPTPTL------ 186

  Fly   190 PEAPSREPGADSIVPGKST----IETDE 213
            ||||:.:....:....|:|    :|.|:
  Fly   187 PEAPTEDLPEKAKEKKKATTTTAVEDDD 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps60NP_001261994.1 Snf7 1..190 CDD:304451 53/195 (27%)
shrbNP_610462.3 Snf7 20..193 CDD:281366 50/185 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88209841
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22761
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.