DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps60 and SPCC162.06c

Sequence 1:NP_001261994.1 Gene:Vps60 FlyBaseID:FBgn0036740 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001342736.1 Gene:SPCC162.06c PomBaseID:SPCC162.06c Length:210 Species:Schizosaccharomyces pombe

Alignment Length:194 Identity:81/195 (42%)
Similarity:128/195 (66%) Gaps:7/195 (4%)


  Fly     1 MNRLFGRGKPKEPGPSLNDCIAGVDARATNIEEKISNLEAELRKYREQMSKMREGPAKNSVKQKA 65
            |:|||||..|.:|..||.|.|..:|.|:.::|.||:.|:|:|..::::::..|.||.:.::||:|
pombe     1 MHRLFGRKPPTQPTASLTDAIDSLDKRSDSVEVKIAKLDAQLSVFQQKIANTRPGPGQTALKQRA 65

  Fly    66 LRVLKQKKAYEQQAESLRNQSFNMEQANYAAQSLKDTQATVAAMKDGVKQMKTEYKKINIDQIED 130
            :.||:|||.||.|.:.|:.||||||||....:|||:|.|||..|::..:|:|::.|.::|::||.
pombe    66 MNVLRQKKIYESQLQQLQQQSFNMEQAAMTTESLKNTMATVQTMQETARQLKSQSKNVSIEKIEK 130

  Fly   131 IQDDMADMFEQADEVQEALGRTYGMPEVDDDDLQAELDALGDEIALDDDTSYLDDVVKAPEAPS 194
            :||::.|..:.|.|:.|.||:......||:::|.|||:||..|      :|:|.|...| |.||
pombe   131 LQDEIQDYMDAAGELNEVLGQNMTDINVDEEELDAELEALQQE------SSWLGDQSTA-EKPS 187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps60NP_001261994.1 Snf7 1..190 CDD:304451 78/189 (41%)
SPCC162.06cNP_001342736.1 Snf7 1..>151 CDD:328813 65/150 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H5757
Inparanoid 1 1.050 155 1.000 Inparanoid score I1261
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003082
OrthoInspector 1 1.000 T1125714
orthoMCL 1 0.900 OOG5_128328
Panther 1 1.100 LDO PTHR22761
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2003
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.