DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps60 and vps-60

Sequence 1:NP_001261994.1 Gene:Vps60 FlyBaseID:FBgn0036740 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_505219.1 Gene:vps-60 WormBaseID:WBGene00018290 Length:217 Species:Caenorhabditis elegans

Alignment Length:221 Identity:122/222 (55%)
Similarity:164/222 (74%) Gaps:6/222 (3%)


  Fly     1 MNRLFGRGKPKEPGPSLNDCIAGVDARATNIEEKISNLEAELRKYREQMSKMREGPAKNSVKQKA 65
            |||:||.|| |.|.|.||:.|:.|::|:.:|::||..|:.:|.|.|:|||||||||:||.:||||
 Worm     1 MNRIFGTGK-KVPPPDLNNAISNVESRSDSIDKKIQKLDQDLMKLRDQMSKMREGPSKNLIKQKA 64

  Fly    66 LRVLKQKKAYEQQAESLRNQSFNMEQANYAAQSLKDTQATVAAMKDGVKQMKTEYKKINIDQIED 130
            |||||||:.||.|...|..|:|||:|:|:|.|.:||.|.||||||||:|.|:.||||:|||||||
 Worm    65 LRVLKQKRMYENQKGQLDQQAFNMDQSNFAIQGMKDNQVTVAAMKDGLKTMQKEYKKMNIDQIED 129

  Fly   131 IQDDMADMFEQADEVQEALGRTYGMPEVDDDDLQAELDALGDEIAL-DDDTSYLDDVVKAPEAPS 194
            :||.|.||.:..:|:|||:.|.|..|::|:.||:|||..||||:.: :.||:|||:.:.||..||
 Worm   130 LQDQMEDMLDMNNEIQEAMSRQYDTPDIDEADLEAELAMLGDELDIGESDTNYLDEALAAPTVPS 194

  Fly   195 REPGADSIVPGKSTIETDEFGLPKIP 220
            .:| ...:..|   :|.|||||||:|
 Worm   195 DKP-KTRVAEG---LEVDEFGLPKLP 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps60NP_001261994.1 Snf7 1..190 CDD:304451 108/190 (57%)
vps-60NP_505219.1 Snf7 1..191 CDD:304451 109/191 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C273811006
eggNOG 1 0.900 E1_KOG1655
Hieranoid 1 1.000
Homologene 1 1.000 H5757
Inparanoid 1 1.050 243 1.000 Inparanoid score I2054
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1301560at2759
OrthoFinder 1 1.000 FOG0003082
OrthoInspector 1 1.000 T475540
orthoMCL 1 0.900 OOG5_128328
Panther 1 1.100 LDO PTHR22761
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2003
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.