DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and Elk1

DIOPT Version :10

Sequence 1:NP_730288.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_001101529.1 Gene:Elk1 / 314436 RGDID:1598663 Length:427 Species:Rattus norvegicus


Alignment Length:85 Identity:45/85 - (52%)
Similarity:64/85 - (75%) Gaps:1/85 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   789 LWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQR 853
            ||:|||:||:::.. ...|.||:|:.|.|||||::.|:||||:.|||.:|||:.:.|||||||.:
  Rat     7 LWQFLLQLLREQGN-GHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDK 70

  Fly   854 GILAKVDGQRLVYQFVDVPK 873
            .|:.||.||:.||:||..|:
  Rat    71 NIIRKVSGQKFVYKFVSYPE 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_730288.1 ETS 786..872 CDD:197710 44/82 (54%)
Elk1NP_001101529.1 ETS 4..89 CDD:197710 44/82 (54%)
PHA03247 <100..427 CDD:223021
PHA03132 112..>246 CDD:222997
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..146
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..202
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..252
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..350
Sufficient for interaction with MAD2L2. /evidence=ECO:0000250|UniProtKB:P19419 348..398
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.