DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and Ehf

DIOPT Version :10

Sequence 1:NP_730288.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_001099963.1 Gene:Ehf / 295965 RGDID:1310282 Length:300 Species:Rattus norvegicus


Alignment Length:103 Identity:45/103 - (43%)
Similarity:68/103 - (66%) Gaps:2/103 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   766 KKPRKPKLEMGVKRRSREGSTTYLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWG 830
            ||.:...::...|:.:..|  |:||||:..:|...:..|..|||.:|.:|:|:.:.|:||::|||
  Rat   188 KKEQDHPVKSHTKKHNPRG--THLWEFIRDILLSPDKNPGLIKWEDRSEGIFRFLKSEAVAQLWG 250

  Fly   831 MHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQF 868
            ..||...|.||.:.||:||||:|.||.:|||:||||:|
  Rat   251 KKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKF 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_730288.1 ETS 786..872 CDD:197710 41/83 (49%)
EhfNP_001099963.1 SAM_PNT-ESE-3-like 39..116 CDD:188882
ETS 206..293 CDD:197710 42/85 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.