DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG7432

DIOPT Version :10

Sequence 1:NP_648995.3 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster


Alignment Length:60 Identity:16/60 - (26%)
Similarity:23/60 - (38%) Gaps:13/60 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVLIFVEANAATQGKNTTIPALIVFGDSIMDTGNNNNLPTLLKCNFPPYGKDYPGGFATG 69
            ||...|.|.||        |..:|||.......:.:::|..:     |..:..|..||.|
  Fly    12 LVSACVMAMAA--------PKQMVFGFGKRSMADISDMPEDV-----PMKRYKPRSFAMG 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_648995.3 Tryp_SPc 27..263 CDD:238113 10/43 (23%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 475..718 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.