DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nedd4 and Wwp2

Sequence 1:NP_648993.1 Gene:Nedd4 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_080106.1 Gene:Wwp2 MGIID:1914144 Length:870 Species:Mus musculus

Alignment Length:1026 Identity:318/1027 (31%)
Similarity:445/1027 (43%) Gaps:328/1027 (32%)


  Fly   105 DINIDSVLTKTKK--KTLNPT---WNEEFIFRVKPSEHKLVFQVFDENRLTRDDFLGMVELTL-- 162
            ::.:|.:.::|||  |.:..:   |||..:..|....| |..:|:..:.| |::.||...:.|  
Mouse    43 EVAVDGLPSETKKTGKRIGSSELLWNEIIVLNVTAQSH-LDLKVWSCHTL-RNELLGTASVNLSN 105

  Fly   163 ---------------VNLPTEQEGRTI--GE---------------------------------- 176
                           :||.||.:|..:  ||                                  
Mouse   106 VLKNNGGKMENTQLTLNLQTENKGSVVSGGELTIFLDGPTVDLGSVPNGSAVTDGSQPPSRESSG 170

  Fly   177 -------------------------------QSYTLRPRRSVGAKSR-------------IKGTL 197
                                           ::.|....:|.||::|             ..||:
Mouse   171 TAIAPETRHQPPSTNCFGGRSRTHRHSGGSARTATAASEQSPGARNRHRQPVKNSSSSGLANGTV 235

  Fly   198 RIYHAFIRETRE----------------QSEPSSGNSDGEWEHVEATNAGETSAQPHPFPTGGHD 246
            ........|..|                .|.|::.:...:....|...|..:..|..|......|
Mouse   236 NEEPTPASEPEESSVVGVTSLPAAALSVSSNPNTTSLPAQSTPAEGEEASTSGTQQLPAAAQAPD 300

  Fly   247 ALPAGWEERQDANGRTYYVNHTARTTQWDRPTVLNSHSSQSTDDQLASDFQRRFHISVDDTESGR 311
            |||||||:|:..|||.|||:|..:||.|:||                                  
Mouse   301 ALPAGWEQRELPNGRVYYVDHNTKTTTWERP---------------------------------- 331

  Fly   312 SADSISHNSIEDNNNAAGLAYTPKTAATSSAPPNTPTNNNGILAQIAMQYRAEEDQDPT-----V 371
                                          .||..                 |:..||.     |
Mouse   332 ------------------------------LPPGW-----------------EKRTDPRGRFYYV 349

  Fly   372 DHTSFVYNSLRHPVAHRQPEISATSLQNDLRPVREAPGVPDIAITNPFTRRAAGNMAGGAGWQQE 436
            ||.:                 ..|:.|   ||..|                              
Mouse   350 DHNT-----------------RTTTWQ---RPTAE------------------------------ 364

  Fly   437 RRRQQMQLHIQQHQQRQQQQQQNRILLDVDHRQQEPQHRGQRHQQQHRPSNEDTDHTDSHNPSDI 501
                    :::.::|.|.|:.|         .|...||..||...|  .|:..|||         
Mouse   365 --------YVRNYEQWQSQRNQ---------LQGAMQHFSQRFLYQ--SSSASTDH--------- 401

  Fly   502 SAPSTRRNSEEDNAAVPPMEQNTGGEEEPLPPRWSMQVAPNGRTFFIDHASRRTTWIDPRNGRAS 566
                            .|:        .||||.|..: ..|||.::::|.:|.|.|.|||.....
Mouse   402 ----------------DPL--------GPLPPGWEKR-QDNGRVYYVNHNTRTTQWEDPRTQGMI 441

  Fly   567 PMPNQTRRVEDDLGPLPEGWEERVHTDGRVFYIDHNTRTTQWEDPRLSNPNIAGQAVP--YSRDY 629
            ..|           .||.|||.:..::|..:::|||||||.::|||....:...|..|  |.|.:
Mouse   442 QEP-----------ALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGAYDRSF 495

  Fly   630 KQKYEYFKSHIRKPTNVPNKFEIRIRRTSILEDSYRIISSVTKTDLLKTKLWVEFEGETGLDYGG 694
            :.||..|: .:.....:|:..:|.:.|.::.|||::.|.::...| |:.:|::...||.||||||
Mouse   496 RWKYHQFR-FLCHSNALPSHVKISVSRQTLFEDSFQQIMNMKPYD-LRRRLYIIMRGEEGLDYGG 558

  Fly   695 LAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQINNGSGLCNEEHLSYFKFIGRIAGMAVYHGKLL 759
            :|||||:|||.|:.||.|.||||:..:||.||||..|.: |.:||:||:||||...||:||||.:
Mouse   559 IAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSI-NPDHLTYFRFIGRFIAMALYHGKFI 622

  Fly   760 DAFFIRPFYKMMLQKPIDLKDMESVDTEYYNSLMWIKENDPRI--LELTFCLDEDVFGQKSQHEL 822
            |..|..||||.||.|...|||:||:|.|:|||::|||||:...  |||.|..|.::.|:.:.|||
Mouse   623 DTGFTLPFYKRMLNKRPTLKDLESIDPEFYNSIVWIKENNLEECGLELFFIQDMEILGKVTTHEL 687

  Fly   823 KPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIKIFDEHELELLMCGI 887
            |.||.||.||.|||:|||.|:.:|||...|:||..:|||||..:.||..::.|||.||||::||:
Mouse   688 KEGGENIRVTEENKEEYIMLLTDWRFTRGVEEQTKAFLDGFNEVAPLEWLRYFDEKELELMLCGM 752

  Fly   888 QNIDVKDWRENTLYKGDYHMNHIIIQWFWRAVLSFSNEMRSRLLQFVTGTSRVPMNGFKELYGSN 952
            |.||:.||::|.:|: .|..:...|||||:.|....||.|.|||||||||.|:|:.||.||.|||
Mouse   753 QEIDMSDWQKNAIYR-HYTKSSKQIQWFWQVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSN 816

  Fly   953 GPQMFTIEKWGTPNNFPRAHTCFNRLDLPPYEGYLQLKDKLIKAIEGSQGF 1003
            |||.|.|::.|.....||:||||||||||||:.|.|||:||:.|||.::||
Mouse   817 GPQKFCIDRVGKETWLPRSHTCFNRLDLPPYKSYEQLKEKLLYAIEETEGF 867

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999 31/201 (15%)
WW 248..277 CDD:278809 18/29 (62%)
WW 531..560 CDD:278809 12/29 (41%)
WW 581..613 CDD:197736 16/32 (50%)
HECTc 650..1003 CDD:238033 189/355 (53%)
HECTc 674..1003 CDD:214523 183/331 (55%)
Wwp2NP_080106.1 C2_E3_ubiquitin_ligase 17..142 CDD:175988 24/101 (24%)
WW 302..331 CDD:278809 18/29 (62%)
WW 332..361 CDD:278809 11/66 (17%)
WW 407..435 CDD:278809 12/29 (41%)
WW 447..477 CDD:238122 15/30 (50%)
HECTc 516..868 CDD:238033 190/356 (53%)
HECTc 539..867 CDD:214523 183/331 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116434459
eggNOG 1 0.900 E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000148
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127296
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2273
TreeFam 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.