DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nedd4 and wwtr1

Sequence 1:NP_648993.1 Gene:Nedd4 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001032785.1 Gene:wwtr1 ZFINID:ZDB-GENE-051101-1 Length:391 Species:Danio rerio

Alignment Length:222 Identity:49/223 (22%)
Similarity:74/223 (33%) Gaps:80/223 (36%)


  Fly   479 HQQQHRPSNEDTDHTDSHNPSDISAPSTRRN-------------------SEEDNAAVPP----- 519
            ||..|...:.|||.....|......||:.||                   |..|:.::||     
Zfish    12 HQVIHVAKDLDTDLEALFNSVMNPKPSSWRNKDMPQSFFQEPDSGSHSRQSSADSGSLPPRVHFR 76

  Fly   520 ----------------------MEQNTG------GEEEPLPPRWSMQVAPNGRTFFIDHASRRTT 556
                                  :..:|.      .||.||||.|.|...|||:.:|::|..:.||
Zfish    77 SRSSPASLQLPAGSVSGPSPGRLHSHTRHQSCDVAEELPLPPGWEMAFTPNGQKYFLNHIEKITT 141

  Fly   557 WIDPRNGRASPMPNQTRRVEDDLGPLPEGWEERVHTDGRVFYIDHNTRTTQWEDPRLSNPNIAGQ 621
            |.|||....                 |...:..:|..      ..||.:.|.....||.||:   
Zfish   142 WHDPRKSMT-----------------PSVAQLSLHNQ------VSNTASIQQRSMALSQPNL--- 180

  Fly   622 AVPYSRDYKQKYEYFKSHIRK-PTNVP 647
             |...:.::|:.::.:...:: |..||
Zfish   181 -VLNQQAHQQQQQHLQQQQQQVPVQVP 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809 14/29 (48%)
WW 581..613 CDD:197736 5/32 (16%)
HECTc 650..1003 CDD:238033
HECTc 674..1003 CDD:214523
wwtr1NP_001032785.1 WW 115..146 CDD:197736 16/31 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.