DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nedd4 and smurf2

Sequence 1:NP_648993.1 Gene:Nedd4 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001107898.1 Gene:smurf2 ZFINID:ZDB-GENE-030131-1830 Length:765 Species:Danio rerio

Alignment Length:1000 Identity:320/1000 (32%)
Similarity:442/1000 (44%) Gaps:317/1000 (32%)


  Fly    72 LRIVVLTGQSLAKKDIFGASDPYVRIDLNTINGDINIDSVLTKTKKKTLNPTWNEEFIFRVKPSE 136
            ||:.||..::|.|||.|...||:.::   .::|.....|  |.|.:.||:|.||:.:...:..|:
Zfish    14 LRLTVLCAKNLVKKDFFRLPDPFAKV---VVDGSGQCHS--TDTVRNTLDPKWNQHYDLYIGKSD 73

  Fly   137 HKLVFQVFDENRLTRDD---FLGMV----------------ELTLVNLPTEQEGRTIGEQSYTLR 182
             .:...|::..::.:..   |||.|                .|.|..|.........|:...:|:
Zfish    74 -SITISVWNHKKIHKKQGAGFLGCVRLLSNSINRLKDTGYQRLDLNKLGPNDSDTVRGQIVVSLQ 137

  Fly   183 PRRSVGAKSRIKGTLRIYHAFIRETREQSEPSSGNSDGEWEHVEATNAGETSAQPHPFPTGGHDA 247
            .|..:|:...:....|::                  |.:                          
Zfish   138 SRDRIGSGGPVVDCSRLF------------------DND-------------------------- 158

  Fly   248 LPAGWEERQDANGRTYYVNHTARTTQWDRPTVLNSHSSQSTDDQLASDFQRRFHISVDDTESGRS 312
            ||.|||||:.|:||..|:||..|:|||:|||            :.||::          :..||.
Zfish   159 LPDGWEERRTASGRIQYLNHITRSTQWERPT------------RPASEY----------SSPGRP 201

  Fly   313 ADSISHNSIEDNNNAAGLAYTPKTAATSSAPPNTPTNNNGILAQIAMQYRAEEDQDPTVDHTSFV 377
            ...:    :::|                 .|..||   ||                         
Zfish   202 LSCL----VDEN-----------------TPIMTP---NG------------------------- 217

  Fly   378 YNSLRHPVAHRQPEISATSLQNDLRPVREAPGVPDIAITNPFTRRAAGNMAGGAGWQQERRRQQM 442
                                         |.|||                               
Zfish   218 -----------------------------AAGVP------------------------------- 222

  Fly   443 QLHIQQHQQRQQQQQQNRILLDVDHRQQEPQHRGQRHQQQHRPSNEDTDHTDSHNPSDISAPSTR 507
                                .| |.|.||.:.|.|||:..       ...|..|.|.|       
Zfish   223 --------------------AD-DPRVQERRVRSQRHRNY-------MSRTHLHTPPD------- 252

  Fly   508 RNSEEDNAAVPPMEQNTGGEEEPLPPRWSMQVAPNGRTFFIDHASRRTTWIDPRNGRASPMPNQT 572
                                   ||..:..:....|:.:|:...:..:||.|||      :|...
Zfish   253 -----------------------LPEGYEQRTTQQGQVYFLHTQTGVSTWHDPR------VPRDL 288

  Fly   573 RRVE-DDLGPLPEGWEERVHTDGRVFYIDHNTRTTQWEDPRLS-------NPNIAGQ-------- 621
            ..|. ::|||||.|||.|....|||:::|||.||||:.|||||       ||:..|.        
Zfish   289 SNVNCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNPSPNGSRAAVEAQS 353

  Fly   622 ---------------------------AVP-YSRDYKQKYEYFKSHIRKPTNVPNKFEIRIRRTS 658
                                       .|| |.||..||.:..:..:.:.........|.:.|..
Zfish   354 SSRPGQLKEQAQSVVSPGNLPEDPECLTVPKYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREE 418

  Fly   659 ILEDSYRIISSVTKTDLLKTKLWVEFEGETGLDYGGLAREWFYLLSKEMFNPYYGLFEYSAMDNY 723
            |.|:|||.:..:...||.| :|.|:|.||.||||||:||||.||||.||.|||||||:||..|.|
Zfish   419 IFEESYRQVMKMRPKDLWK-RLMVKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIY 482

  Fly   724 TLQINNGSGLCNEEHLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMMLQKPIDLKDMESVDTEY 788
            |||||..|.: |.||||||.|:|||.||||:||..:|..|..||||.:|.|||.|.||||||.:.
Zfish   483 TLQINPDSAV-NPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKPITLDDMESVDPDL 546

  Fly   789 YNSLMWIKEND-PRILELTFCLDEDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARV 852
            :|||:||.:|| ..:|:.|||::.:.:|:..||||||.|.:|.||.:.|.||::|.:.|||:..:
Zfish   547 HNSLVWILDNDITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVTQDTKKEYVRLYVNWRFLRGI 611

  Fly   853 KEQMSSFLDGFGSIIPLNLIKIFDEHELELLMCGIQNIDVKDWRENTLYKGDYHM--NHIIIQWF 915
            :.|..:...||..:||.:|:|.|||.||||::||:..||:.||:.||..|   |.  :..|::||
Zfish   612 EAQFLALQKGFNEVIPQHLLKAFDEKELELIVCGLGKIDINDWKSNTRLK---HCTPDSNIVKWF 673

  Fly   916 WRAVLSFSNEMRSRLLQFVTGTSRVPMNGFKELYGSNGPQMFTIEKW-GTPNNFPRAHTCFNRLD 979
            ||||.|:..|.|:||||||||:||||:.|||.|.|:.||::|||.:. .:.||.|:|||||||:|
Zfish   674 WRAVESYDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDASTNNLPKAHTCFNRID 738

  Fly   980 LPPYEGYLQLKDKLIKAIEGSQGFA 1004
            :||||.|.:|.|||:.|||.:.|||
Zfish   739 IPPYESYDKLYDKLLTAIEETCGFA 763

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999 34/151 (23%)
WW 248..277 CDD:278809 18/29 (62%)
WW 531..560 CDD:278809 7/29 (24%)
WW 581..613 CDD:197736 20/32 (63%)
HECTc 650..1003 CDD:238033 191/357 (54%)
HECTc 674..1003 CDD:214523 184/333 (55%)
smurf2NP_001107898.1 C2_Smurf-like 13..137 CDD:176028 31/129 (24%)
WW 159..188 CDD:278809 18/29 (62%)
WW 252..283 CDD:197736 9/61 (15%)
WW 298..330 CDD:197736 20/32 (63%)
HECTc 410..762 CDD:238033 191/357 (54%)
HECTc 437..762 CDD:214523 182/330 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000148
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2273
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.