DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nedd4 and nedd4l

Sequence 1:NP_648993.1 Gene:Nedd4 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_012815048.1 Gene:nedd4l XenbaseID:XB-GENE-489248 Length:1290 Species:Xenopus tropicalis

Alignment Length:1189 Identity:476/1190 (40%)
Similarity:626/1190 (53%) Gaps:264/1190 (22%)


  Fly     6 SGLVAAAA-----LPVPSSSSSVAGGDVPRPP--PRRRAASVAGQQQTRQEFGNGYTPRR-SLAA 62
            :|.:..||     :.:.:|..:.:|..:.|.|  |..|...:....|..|. |:...||| ||..
 Frog   179 NGHINCAADMQEEVSITTSGQNTSGIRIKRQPLSPDIRQVRLLSPCQENQN-GSNTEPRRWSLQH 242

  Fly    63 VNDSGDSCHLRIVVL------TGQS-LAKKDIFGASD---------PYVRIDLNTI--------- 102
            :.|:..|...|..|.      ||.| :..:..||.:.         |.:|::.:|.         
 Frog   243 LPDTSGSPGKRCFVFQLQQSQTGNSNMGGEYNFGFTGTKGDRLVRYPRIRLERSTSYPLQPRPES 307

  Fly   103 -----NGDINIDSVLTKTKKKTLNPTWNEEFIFRVKPSEHK-LVFQVFDENRL------------ 149
                 ||   :.|...|.||.......|:.   |.:||:.: ..|::..|:.:            
 Frog   308 TSPVENG---LSSESGKCKKDYAEILPNDS---RERPSQGQGCTFKIRQESNVRQPHFRIRVTRS 366

  Fly   150 ----------------------TRDDFLGMVELTLVNLPTEQEGRTIGEQSYT-----LRPRRSV 187
                                  |||||||.|::.|.:||||....   |:.||     ||||   
 Frog   367 SEEQGTEEGQDVPRNSALGKATTRDDFLGQVDVPLNHLPTEDPTM---ERPYTFKDFLLRPR--- 425

  Fly   188 GAKSRIKGTLRIYHAFI-------RETREQSEPSSGNSDGEWEHVEATNAGETSAQPHPFPTGGH 245
            ..|||:||.||:..|::       .|..||.|    .|:..|:.|::.::.....|..|.|    
 Frog   426 SHKSRVKGFLRLKMAYLPKNGMQEEENNEQRE----ESEQAWDVVDSNDSSSPHQQELPAP---- 482

  Fly   246 DALPAGWEERQDANGRTYYVNHTARTTQWDRPTVLNSHSSQSTD-----DQLASDFQRRFHIS-- 303
             .:|.||||:.|..||||||||..:||||.||::::..|...::     .:....|:.|.|||  
 Frog   483 -PMPPGWEEKVDNLGRTYYVNHNNKTTQWQRPSLVDVTSESDSNIRHIQQEAHRVFRSRRHISED 546

  Fly   304 --VDDTESGRSA----DSISHNSIEDNNNAAGLAYTPKTAATSSAPPNTPTNNNGIL-------- 354
              .|..|.|...    ::||..          :..|..|...|..||.:|.:....|        
 Frog   547 LEPDHIEGGADVPEPWETISEE----------MTLTTDTLNQSLPPPASPDSRASALELSEELNR 601

  Fly   355 -AQIAMQYRAEEDQDPTVDHTSFVYNSLRHPVAH-----------RQPEISATSLQ--------- 398
             .||:.:...|  |..::..|::.....|.|...           .|..:|..|:.         
 Frog   602 RLQISSESNGE--QFSSIIQTAWERQKQREPSTRLRSCSVTDGVAEQAHLSLPSVSTGRARSSTV 664

  Fly   399 ---NDLRP----VREAPGVPDIAITNPFTRRAAGNMAGGAGWQQERRRQQMQLHIQQHQQRQ--- 453
               .|..|    |...||:|                   :|| :||:..:.:.:...|..|.   
 Frog   665 TGGEDSTPTVAYVHTTPGLP-------------------SGW-EERKDAKGRTYYVNHNNRTTTW 709

  Fly   454 -----QQQQQNRI--LLDVDHRQQEPQHR-----------------GQRHQQQHRPSNEDTDHTD 494
                 |..:...:  ..:..:...|||.|                 |.:.....|...:...:..
 Frog   710 TRPIVQHAEDGAVGSTSNSSNHLSEPQIRRPRSLSSPTVTLSAPLEGAKDFPVRRAVKDTLSNPQ 774

  Fly   495 SHNPSDISAPSTRRNSEEDNAAVPPMEQNTGGEEEPLPPRWSMQVAPNGRTFFIDHASRRTTWID 559
            |..||..::|..:..                |.:..|||.|.|::|||||.|||||.::.|||.|
 Frog   775 SPQPSPYNSPKPQHK----------------GAQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWED 823

  Fly   560 PR-------NGRASPMPNQTRRVEDDLGPLPEGWEERVHTDGRVFYIDH---------------- 601
            ||       ..:||..||       ||||||.|||||:|.|||.|||||                
 Frog   824 PRLKFPVHMRTKASLNPN-------DLGPLPPGWEERIHGDGRTFYIDHRSPGLRCRDTGTSCSV 881

  Fly   602 ---NTRTTQWEDPRLSNPNIAGQAVPYSRDYKQKYEYFKSHIRKPTNVPNKFEIRIRRTSILEDS 663
               :|:.||||||||.||.|.|.||||||::||||:||:..::||.::||:||:::.|.:|.|:|
 Frog   882 PPYDTKITQWEDPRLQNPAITGPAVPYSREFKQKYDYFRKKLKKPADIPNRFEMKLHRNNIFEES 946

  Fly   664 YRIISSVTKTDLLKTKLWVEFEGETGLDYGGLAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQIN 728
            ||.|.||.:.|:||.:||:|||.|.||||||:|||||:||||||||||||||||||.||||||||
 Frog   947 YRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQIN 1011

  Fly   729 NGSGLCNEEHLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMMLQKPIDLKDMESVDTEYYNSLM 793
            ..||||||:|||||.|||||||:||:||||||.|||||||||||.|.|.||||||||:||||||.
 Frog  1012 PNSGLCNEDHLSYFTFIGRIAGLAVFHGKLLDGFFIRPFYKMMLGKQITLKDMESVDSEYYNSLK 1076

  Fly   794 WIKENDPRILELTFCLDEDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSS 858
            ||.||||..|:|.||:||:.|||..|.:|||.|:.:.|||:||.|||.|||:||||.||::||::
 Frog  1077 WILENDPTELDLRFCIDEENFGQTYQVDLKPNGSEMVVTNDNKREYIDLVIQWRFVNRVQKQMNA 1141

  Fly   859 FLDGFGSIIPLNLIKIFDEHELELLMCGIQNIDVKDWRENTLYKGDYHMNHIIIQWFWRAVLSFS 923
            ||:||..:||::|||||||:||||||||:.::||.|||::||||..|..||..|||||:|||...
 Frog  1142 FLEGFTELIPIDLIKIFDENELELLMCGLGDVDVNDWRQHTLYKNGYCPNHPAIQWFWKAVLLMD 1206

  Fly   924 NEMRSRLLQFVTGTSRVPMNGFKELYGSNGPQMFTIEKWGTPNNFPRAHTCFNRLDLPPYEGYLQ 988
            .|.|.|||||||||||||||||.|||||||||:||||:||:|:..|||||||||||||||:.:..
 Frog  1207 AEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPDKLPRAHTCFNRLDLPPYDSFED 1271

  Fly   989 LKDKLIKAIEGSQGFAGVD 1007
            |::||:.|:|.:|||.|||
 Frog  1272 LREKLLMAVENAQGFEGVD 1290

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999 50/203 (25%)
WW 248..277 CDD:278809 19/29 (66%)
WW 531..560 CDD:278809 19/29 (66%)
WW 581..613 CDD:197736 25/51 (49%)
HECTc 650..1003 CDD:238033 247/353 (70%)
HECTc 674..1003 CDD:214523 236/329 (72%)
nedd4lXP_012815048.1 C2 <389..442 CDD:301316 28/59 (47%)
WW 485..513 CDD:238122 19/28 (68%)
WW 683..712 CDD:278809 7/49 (14%)
WW 796..826 CDD:238122 20/30 (67%)
WW 845..896 CDD:197736 25/51 (49%)
HECTc 933..1287 CDD:238033 248/354 (70%)
HECTc 957..1286 CDD:214523 236/329 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115723469
eggNOG 1 0.900 E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H86986
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000148
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2273
TreeFam 1 0.960
87.740

Return to query results.
Submit another query.