DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nedd4 and pub2

Sequence 1:NP_648993.1 Gene:Nedd4 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_593926.1 Gene:pub2 PomBaseID:SPAC1805.15c Length:671 Species:Schizosaccharomyces pombe

Alignment Length:442 Identity:191/443 (43%)
Similarity:288/443 (65%) Gaps:19/443 (4%)


  Fly   573 RRVEDDLGPLPEGWEERVHTDGRVFYIDHNTRTTQWEDPRLSNPNIAGQAVPYSRD--------Y 629
            ::|..:.||||.|||.|:..|..|:::||:|:||.|.|||  :..:|..:|..:.|        |
pombe   235 QQVAVEKGPLPAGWEMRLSEDYHVYFVDHSTKTTTWSDPR--DNVVASDSVSENTDSIQQINDEY 297

  Fly   630 KQKYEYFKSHIRKPTNVPN--KFEIRIRRTSILEDSYRIISSVTKTDLLKTKLWVEFEGETGLDY 692
            ::|..|...   :|....|  :.::::.|.:..||:|.|||.::.:| :|.||.:.|..|.||||
pombe   298 QRKIAYMYD---RPEMAVNDAQLQLKVSRATTFEDAYDIISKLSVSD-MKKKLLIRFRNEDGLDY 358

  Fly   693 GGLAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQINNGSGLCNEEHLSYFKFIGRIAGMAVYHGK 757
            ||::||:||:||..:|||.|.||||:..|||.|||:..|.: |.:..|||:|:||:.|:|:||.:
pombe   359 GGVSREFFYILSHAIFNPGYSLFEYATDDNYGLQISPLSSV-NPDFRSYFRFVGRVMGLAIYHRR 422

  Fly   758 LLDAFFIRPFYKMMLQKPIDLKDMESVDTEYYNSLMWIKEND-PRILELTFCLDEDVFGQKSQHE 821
            .||..|:.||||.:||||:.|:|::.||..||.||.|||.|| ...|.|.|.::|:.||:....:
pombe   423 YLDVQFVLPFYKRILQKPLCLEDVKDVDEVYYESLKWIKNNDVDESLCLNFSVEENRFGESVTVD 487

  Fly   822 LKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIKIFDEHELELLMCG 886
            |.|.|.||.|.|:||..|:|.:.|.:.|...:||.::...|...:||.::::||:|:||:.|:.|
pombe   488 LIPNGRNIAVNNQNKMNYLKALTEHKLVTSTEEQFNALKGGLNELIPDSVLQIFNENELDTLLNG 552

  Fly   887 IQNIDVKDWRENTLYKGDYHMNHIIIQWFWRAVLSFSNEMRSRLLQFVTGTSRVPMNGFKELYGS 951
            .::|||:||:..|.|:.....:.|:| |||..:..:|.|.:::||||.|||||:|::|||:::||
pombe   553 KRDIDVQDWKRFTDYRSYTETDDIVI-WFWELLSEWSPEKKAKLLQFATGTSRLPLSGFKDMHGS 616

  Fly   952 NGPQMFTIEKWGTPNNFPRAHTCFNRLDLPPYEGYLQLKDKLIKAIEGSQGF 1003
            :||:.|||||.|..:..|:|||||||||:|||....:|:.||..||:.:.||
pombe   617 DGPRKFTIEKVGHISQLPKAHTCFNRLDIPPYNSKEELEQKLTIAIQETAGF 668

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736 18/32 (56%)
HECTc 650..1003 CDD:238033 162/354 (46%)
HECTc 674..1003 CDD:214523 155/330 (47%)
pub2NP_593926.1 HUL4 1..671 CDD:227354 191/443 (43%)
C2_Smurf-like 7..128 CDD:176028
WW 243..275 CDD:197736 18/34 (53%)
HECTc 317..669 CDD:238033 163/356 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11254
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.