DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nedd4 and yap-1

Sequence 1:NP_648993.1 Gene:Nedd4 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_509789.2 Gene:yap-1 WormBaseID:WBGene00008748 Length:442 Species:Caenorhabditis elegans

Alignment Length:261 Identity:57/262 (22%)
Similarity:100/262 (38%) Gaps:59/262 (23%)


  Fly   248 LPAGWEERQDANGRTYYVNHTARTTQWDRPTVLNSHSSQSTDDQLASDF-QRRFHISVDDTESGR 311
            :|.|||...|::|..|:.:|.::||.||.|.:   ...:.|...|..:. |.|::...|:..|.|
 Worm   205 MPQGWEMCYDSDGVRYFKDHNSKTTTWDDPRL---KQQEQTGFGLGENIGQNRYNNCYDNGHSSR 266

  Fly   312 SADSISHNSIEDNNNAAGLAYTPKTAATSSAPPNTPTNNNGILAQIAMQYRAEEDQDPTVDHTSF 376
            |..||..:                    ....||.|          ..||.:::.    :|:...
 Worm   267 SLPSIHQH--------------------QQMIPNHP----------QPQYSSQQQ----MDYIQQ 297

  Fly   377 VYNSLRHPVAHRQPEISATSLQNDLRPVREAPGVPDIAITNPFTRRAAGNMAGGAGWQQERRRQQ 441
            :.|. |..:..:..::..:.|.:..:|..:|        .:|.:.....:......:||:::.|.
 Worm   298 LQNE-RMMIQEKNAQLINSGLVDSPQPPYQA--------ISPMSSTMMHSHDPNFMYQQQQQAQN 353

  Fly   442 MQ-------LHIQQHQQRQQQQQQNRILLDVDH----RQQEPQHRGQRHQQQHRPSNEDTDHTDS 495
            .|       || |...|.|..|..:...::||:    ..|:.||:.|.|...:.|||...|..:.
 Worm   354 SQQQQTPHTLH-QIPNQYQNSQMNDDSAMEVDYSMVSHPQQLQHQHQPHMHNNMPSNYVIDDINP 417

  Fly   496 H 496
            |
 Worm   418 H 418

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809 12/29 (41%)
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033
HECTc 674..1003 CDD:214523
yap-1NP_509789.2 WW 206..236 CDD:238122 13/30 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.