DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nedd4 and hecw-1

Sequence 1:NP_648993.1 Gene:Nedd4 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001317872.1 Gene:hecw-1 WormBaseID:WBGene00009738 Length:1247 Species:Caenorhabditis elegans

Alignment Length:1036 Identity:258/1037 (25%)
Similarity:406/1037 (39%) Gaps:311/1037 (30%)


  Fly    65 DSGDSC----------HLRIVVLTGQSLAKKDIFGASDPY------------------------- 94
            |:.||.          |:..||.|   |..|::..||:.|                         
 Worm   425 DNNDSSFYLDQKSLRQHISPVVFT---LTSKNLLNASEVYFGLIDGMTGRLLAKSENVEICKSAS 486

  Fly    95 -----------VRIDLNTINGDINIDSVLTKTKKKTLNPTWNE--EFIFRVKPSEHKLVFQVFDE 146
                       :.:.|||.:|.|.|....:.::|   |.::..  ||.|.|:.....||     |
 Worm   487 LVVHEVKKPENINVYLNTNHGRIEIPKKRSFSRK---NGSFRSSFEFDFDVEDLHISLV-----E 543

  Fly   147 N--RLTRDDFLGMVELTLVNLPTEQEGRTIGEQSYTLRPRRSVGAKSRIKGTLRIYHAFIRETRE 209
            |  :|..|.|:...:|         :...|..:|::                    |:.:.|...
 Worm   544 NSEKLNFDHFIASNQL---------QNNYIQSKSFS--------------------HSHVVEIVF 579

  Fly   210 QSEPSSGNSDGEWEHVEATNAGETSAQPHPFPTGGHDALPAGWEERQDANGRTYYVNHTARTTQW 274
            ..||.:...... :.:|..::.:|..:.|             |:...||..|.:||||..:.|:|
 Worm   580 SIEPKTSKKSAP-DIMEIASSSQTPPESH-------------WKTYLDAKKRKFYVNHVTKETRW 630

  Fly   275 DRPTVLNSHSSQSTDDQLASDFQRRFHISVDDTESGRSADSISHNSIEDNNNAAGLAYTPKTAAT 339
            .:|                                    |::::|.||           |:|   
 Worm   631 TKP------------------------------------DTLNNNHIE-----------PET--- 645

  Fly   340 SSAPPNTPTNNNGILAQIAMQYRAEEDQDPTVDHTSFVYNSLRHPVAHRQPEISATSLQNDLRPV 404
                                                        ||..|..:.||:...:.:.|.
 Worm   646 --------------------------------------------PVHKRLSDRSASPRNSFITPR 666

  Fly   405 REAPGVPDIAITNPFTRRAAGNMAGGAGWQQERRRQQMQLHIQQHQQRQQQQQQNRILLDVDHRQ 469
            |            ..|.|:||  ...:...|..:|.:.:..:.::|...|...:..::....||.
 Worm   667 R------------TITVRSAG--CPKSDLIQFFQRDEFKTALYENQDAMQIYNECSVVRHAIHRI 717

  Fly   470 QEPQHRGQRHQQQHRPSNEDTDHTDSHNPSDISAPSTRRNSEEDNAAVPPMEQNTGGEEEPLPPR 534
            |:                            |:..||...|.......|......|    :|||..
 Worm   718 QK----------------------------DLDPPSKFENQPLFVRFVNLFADIT----QPLPSG 750

  Fly   535 WSMQVAPNGRTFFIDHASRRTTWIDP----------RNGRASPMPNQT----------------- 572
            |.. :..|.||.|::||::.|::.||          |.||:.|..:.|                 
 Worm   751 WEC-ITMNNRTVFLNHANKETSFYDPRIRRFETKTSRRGRSVPSRSSTAHKGKIDHALISKCEDL 814

  Fly   573 RRV-EDDLGPLPEGWEERVHTDGR------------------VFYIDHNTRTTQWEDPRLSNPNI 618
            |:: :|:...:.|...:::....|                  :..:|.||.            .:
 Worm   815 RKIAQDNFPQIAERISKKLMLIERFGGLAVASLANDLDITLALSMLDSNTE------------KL 867

  Fly   619 AGQAVPYSRDYKQKYEYFKSHIRKPTNVPNKFEIRIRRTSILEDSYRIISSVTKTDLLKTKLWVE 683
            ||:    ..:.|..||..|.  .|....|::...::.|..:|:|::|||.:|....|.|::|.:.
 Worm   868 AGE----GDNIKMFYEDMKK--EKLGKGPSRLCWKVSRDRLLDDAFRIILNVDPFVLKKSRLHIR 926

  Fly   684 FEGETGLDYGGLAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQINNGSGLCNEEHLSYFKFIGRI 748
            ||||..||||||:||:|.|||:|:|:|..|.|||...| |.||: ...|...|:...:....||:
 Worm   927 FEGELALDYGGLSREFFILLSRELFHPKNGYFEYEGND-YHLQL-RPRGCETEKEKKWLILCGRV 989

  Fly   749 AGMAVYHGKLLDAFFIRPFYKMMLQKPIDLKDMESVDTEYYNSLMWIKENDPRILELTFCLDEDV 813
            ..:||.|...:|.||...|||.:.::|:.|.|.:..|.|:|.|:.|:.|||...||::|.....|
 Worm   990 LALAVIHRCYIDVFFTNVFYKSLQKRPVTLMDFKESDAEFYKSMNWLLENDVVDLEMSFVYSSMV 1054

  Fly   814 FGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIKIFDEH 878
            .|:.::.||.|||.:..||..||.|:|.|:.:.:.:..|::.:...|..|..|:..||:...:..
 Worm  1055 NGKLAEQELVPGGESQMVTEANKAEFIDLMCQKKAIRGVEKPLEILLTSFNQILNDNLLNSLESS 1119

  Fly   879 ELELLMCGIQNIDVKDWRENTLYKGDYHMNHIIIQWFWRAVLSFSNEMRSRLLQFVTGTSRVPMN 943
            :|:.::.|...:|:.|||.||:|||.|...||:::|||..:.:.:|:.|..||.||||:|.||..
 Worm  1120 DLKRILSGSLELDLNDWRTNTIYKGGYSDCHIVVEWFWEVIETMTNQERFDLLLFVTGSSSVPFE 1184

  Fly   944 GFKELYGSNGPQMFTIEKWGTPNNFPRAHTCFNRLDLPPYEGYLQLKDKLIKAIEGSQGFA 1004
            ||..|.|:.....|.|||||...:|||||||||||.||.|....|||.||.:||.....::
 Worm  1185 GFSALRGNEEISKFCIEKWGDATSFPRAHTCFNRLQLPSYNTKQQLKSKLQQAIVNGMSYS 1245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999 32/173 (18%)
WW 248..277 CDD:278809 10/29 (34%)
WW 531..560 CDD:278809 11/29 (38%)
WW 581..613 CDD:197736 5/50 (10%)
HECTc 650..1003 CDD:238033 143/353 (41%)
HECTc 674..1003 CDD:214523 136/329 (41%)
hecw-1NP_001317872.1 FBA_2 230..285 CDD:311601
WW 603..634 CDD:197736 12/80 (15%)
WW 746..777 CDD:197736 13/32 (41%)
HECTc 918..1244 CDD:214523 136/328 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.